CAZyme Information: MGYG000004158_00798

Basic Information

• Species: Dialister invisus
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; Dialister; Dialister invisus
• CAZyme ID: MGYG000004158_00798
• CAZy Family: GT2
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813		94364.1	6.4616

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004158	1763641	MAG	United Kingdom	Europe

• Gene Location: Start: 58278; End: 60719 Strand: -

Full Sequence      

MESRVGTKPKVSIIIPVYNDSEYLCAALESVKRQTMKEIEVICVDDASEDNSRDIIKEYQ
EQDPRFKAIFHETNLSASEGRKNGVAASTGKYIMFLDGDDELYPDACQAAYDAIEKYGTD
MVHFNSTIVNCANMTEARIQMNVKHIKPYVRKIEADNLISACWKEKKFAFTLWNKIYNGD
ICRLAFSRIEPGAYPKAQDLYAFFVIAYYSRTYMGIDETLYKYNFGLGITGDDNIDLRKY
STLLTESRIYGALVRFMENKPDNEEYEEILESVHEGLFNECFVRWRDNLSKDLKNEGFEL
LVGAFGFKTVLRYLSKKFWYNRTEMAKEFVGIPYFNYIKREPGKQMTIAMYYRCIVNGGA
QRVVSMLCNRWADMVDEEGKPLYNVVLITDEGSCENEYEISPLVKRRYLPRYEVSISEKY
KERMEAWHNLIDENDIDVVVSGMWVAPSNFWDMLCVKGHKSKPAFVIHSHSFCMVPYQFL
GDTGQELCYSYQICDGVVVLSECDHKFVSSFAKHSAWICNPLEFSPLKMPTSSYEPNRLL
WLGRISEEKNPVDSIIMMKYVVKKVPDAKLYIVGDGNQQIIERMKQLITRLHLGNNVELV
GFTLDVQDYYSKSMALICTSKYEGWSLTLGEAMAHGVPVITYDMPWLTFLQDGRGIVTVP
QERYDLLAREVISLLKNPNRIVKIGMEGKQQIIEVANYDIESDWKEFFAELNKEKTYGHS
GQTQTDILLKYLSLYQYEGRKKRAAAEKKKGAEQERRKFNASQRINNEKIKKLENDNDSL
NDVIYHLEHSVSFRVGRMITWFPRMIRDMFVRR

Enzyme Prediction     

No EC number prediction in MGYG000004158_00798.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	12	162	4.4e-33	0.8058823529411765
GT4	537	680	1.2e-24	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03820	GT4_AmsD-like	3.66e-40	358	689	13	334	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
pfam00535	Glycos_transf_2	2.14e-33	12	153	1	142	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd03811	GT4_GT28_WabH-like	4.10e-32	348	700	2	351	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03801	GT4_PimA-like	1.40e-30	357	702	13	356	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd00761	Glyco_tranf_GTA_type	4.73e-30	13	129	1	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOL57828.1	2.45e-70	2	812	374	1153
BBV24393.1	2.45e-70	2	812	374	1153
QSY58246.1	1.38e-59	310	807	34	499
ACD99020.1	2.63e-59	300	807	21	499
QOL52446.1	2.63e-59	300	807	21	499

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BCV_A	3.78e-18	9	159	5	153	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5HEA_A	1.38e-17	11	126	7	123	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
7EC2_A	2.07e-16	535	705	317	487	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC2_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
7EC1_A	1.35e-13	538	707	324	493	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC1_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC4_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC4_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC6_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC6_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFK_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFK_B Chain B, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFM_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFM_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFN_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFN_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]
7EC3_A	1.35e-13	538	707	324	493	ChainA, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7EC3_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFL_A Chain A, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300],7VFL_C Chain C, Glycosyl transferase, group 1 family protein [Staphylococcus aureus subsp. aureus USA300]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71057	7.68e-22	9	297	4	286	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
P13484	7.64e-19	302	704	116	515	Poly(glycerol-phosphate) alpha-glucosyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagE PE=1 SV=1
P11290	1.53e-15	10	104	7	100	Uncharacterized glycosyltransferase YibD OS=Escherichia coli (strain K12) OX=83333 GN=yibD PE=3 SV=2
A0A0H2UR96	5.25e-15	11	122	5	116	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
A0A0H2URH7	9.75e-15	10	228	6	220	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004158_00798.