CAZyme Information: MGYG000004155_00054

Basic Information

• Species: CAG-273 sp003534295
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-273; CAG-273 sp003534295
• CAZyme ID: MGYG000004155_00054
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
810		91850.25	4.8315

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004155	1330798	MAG	United Kingdom	Europe

• Gene Location: Start: 45691; End: 48123 Strand: +

Full Sequence      

MKYKDVIEKMSLEEKASLCVGNDYWHSLELEKYGIPKITMSDGPHGLRVQKTKADNLGIN
ESEISTCFPASASLGNTWNRELIYLLGKTLGKEARKEEVNIVLGPAINIKRSPLCGRNFE
YFSEDSYLTGILGMEYVKGLQSENVGACVKHFAVNNQENRRRTIDVVIDERALREVYLKA
FEMIIKNAKPWSIMSAYNKANGEYCSENQHLLNDILRKEWNFDGIVISDWGAENDRVKGL
KATHELEMPGGRGNGAKEIIEAVKNGEISETKLNEAVDRIIDIARKGSNQFAYDEKLGAY
LEMNKAGKETSFEYDQKVHHEIAEEIAEETIVLLKNDNNILPIKNKKIAVIGDMAKTPRY
QGAGSSTINPYKIENAYDNLVQNGIDVEYAQGYERIESENDEKLRSEAVKVAKNNDVVLV
FAGLTENYESEGVDRETLDMPENQNKLIDEICNVNENVIVVLSNGSPILMPWKDKVKGIL
AGCIGGEAGGKAVVDCILGNVNPNGKLAETYPNKLEDTSCFNNYPGNEITVEYKESVYVG
YKYYDKVGKDVLFPFGFGLSYTEFEYFDLKVNIENEKVDIRFKIKNVGDVAGKEIAQIYV
KKADSVVFRPDKELRDFAKVDLNPGEEKDVHIVLDRDCFEYYDIENDRWQVEAGEYEILV
GKSSRNIVLNDKVVINSDDVCVKKEFCEKYYTGDVQNVADEEFEKLIGRKLPDKVLKIED
ITAENTLEQIKNTAIGKVIYDNQIEKMNRLLREQNVNKATKVMMDLQKPLKKFYEKKSSK
ITKEMVDELIAMAKKGEFSENNAFVKEYLK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	242	1.4e-65	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	6.25e-78	66	667	118	757	beta-glucosidase BglX.
COG1472	BglX	4.76e-65	34	372	59	377	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	4.36e-63	331	561	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	3.34e-49	34	647	75	753	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	7.08e-39	29	281	60	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEN03854.1	9.09e-247	4	742	6	737
AEE95846.1	1.82e-243	6	695	8	686
AUS96756.1	9.90e-243	4	695	6	687
AOZ92946.1	9.96e-243	1	711	1	694
AFU13598.1	1.98e-242	4	717	6	706

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.57e-243	4	753	6	746	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.87e-182	7	678	9	666	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.05e-145	2	669	3	707	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	3.16e-144	2	669	3	707	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	5.22e-123	4	668	7	829	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	4.29e-243	4	753	6	746	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	2.28e-181	7	678	9	675	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	6.40e-181	7	678	9	675	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	4.76e-140	1	667	44	737	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q2U8Y5	3.26e-123	1	668	4	824	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004155_00054.