CAZyme Information: MGYG000004151_03051

Basic Information

• Species: Pseudomonas citronellolis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales; Pseudomonadaceae; Pseudomonas; Pseudomonas citronellolis
• CAZyme ID: MGYG000004151_03051
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548	MGYG000004151_33|CGC1	60721.78	9.7455

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004151	7110046	MAG	United Kingdom	Europe

• Gene Location: Start: 10693; End: 12339 Strand: +

Full Sequence      

MNRRYSLLAGAVLVLFFLVPLGLHGLWIPDETRYAQVAQEMLQRGDWVTPHFLGLRYFEK
PIAGYWLVALGQAAFGENLFGVRFASVLVSACSTLLVWLLGRRLWPQPGRAWMAALLYAS
FALIAGQAGYANLDPQFTLWVNLSLFALWFAFEATSHRARLGAWITLGAACAMGFMTKGF
LAGLLPVLVALPYALWRRRLGELFLLGPLAVLVALLASLPWVLAVHLREPDFWHFFFWHE
HIQRFAGSDAQHARPFWFFVPLLFACAAPWTLLVPAAFQRGWQARRTPHAVFLLLWFAMP
FLFFSLARGKLPTYIMPCFAPLALLMADALACALESGRLRALRLNGALNLLLGLLGLAAL
AFLQAKKALYHQQLPSLLLIGLVCALWALCGALQWLRPQQLWAAPALAAWLLVAAAPAAL
PERMVNSKMPDQFIAQHLEELAGARTLLSNDLGGASALAWRTGRSEVFLLNTEGELKYGL
GYPDAQGRSLSLEGFPAWLADARRKGPVGVILRINSPGDEAELALMPRDVTSYRENHLVF
LLIPQAAP

Enzyme Prediction     

No EC number prediction in MGYG000004151_03051.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	507	1.7e-130	0.9462962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	0.0	3	545	5	552	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	1.04e-60	1	516	4	533	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	1.75e-17	4	236	3	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam13231	PMT_2	7.88e-13	60	221	2	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
COG4346	COG4346	7.95e-04	58	225	134	288	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANI13420.1	0.0	1	548	1	548
QOF82854.1	0.0	1	548	1	548
AMO74575.1	0.0	1	548	1	548
CDF86047.1	8.45e-297	1	548	1	548
AGI22886.1	4.71e-268	11	548	11	548

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	5.66e-34	11	330	39	364	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02R27	3.48e-233	1	548	1	549	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1
A6V1N8	4.02e-232	1	548	1	549	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain PA7) OX=381754 GN=arnT PE=3 SV=1
B7VBN0	2.31e-231	15	548	16	549	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=arnT PE=3 SV=1
Q9HY61	3.27e-231	15	548	16	549	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arnT PE=3 SV=1
Q4KC80	1.17e-226	1	548	1	549	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999763	0.000154	0.000081	0.000001	0.000001	0.000025

TMHMM  Annotations     

start	end
7	29
79	101
114	131
174	196
203	225
256	278
290	307
312	334
341	363
374	396
401	420