CAZyme Information: MGYG000004150_00511

Basic Information

• Species: Comamonas kerstersii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Comamonas; Comamonas kerstersii
• CAZyme ID: MGYG000004150_00511
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000004150_2|CGC1	37479.63	9.8172

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004150	3434704	MAG	United Kingdom	Europe

• Gene Location: Start: 166548; End: 167612 Strand: -

Full Sequence      

MKEKVALIMAGGTGGHIFPGLAVAQALREQGWRVHWLGAPNSMEARLVPTYGFALETIDF
GGVRGKGLTTLALLPLRLLKAFWQSLAVVRRVKPDVLVGFGGYITFPGGMMGVLTGKKLV
LHEQNSVAGAANKVLAGIADRVFTAFPKALKTGQWVGNPLREDFLRQPDPAQRFAGRSGP
LKVLVVGGSLGAKALNDIVPQALALIPAEQRPQVVHQSGAKQIDALRANYEAAGVQAELL
PFIDNMAQAFADADLVICRAGASTVTEIAAVGAAAIYVPFPHAVDDHQTHNAKFLVDAGG
GWLIQQDALNAPKLAEMLQNMQRSVLLNAALKAKTMQKIDATHAVVAACEEIAA

Enzyme Prediction     

No EC number prediction in MGYG000004150_00511.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	183	339	1.8e-49	0.9745222929936306

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	7.45e-162	7	354	5	356	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	1.08e-134	7	347	3	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR01133	murG	2.41e-121	7	349	4	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0707	MurG	5.03e-121	4	354	1	356	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
pfam04101	Glyco_tran_28_C	1.88e-44	183	344	2	163	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQZ97282.1	7.11e-253	1	354	1	354
QTW18598.1	7.11e-253	1	354	1	354
QXW19026.1	3.94e-218	1	354	1	354
QTX21252.1	7.69e-209	1	354	1	354
ANY63201.1	7.69e-209	1	354	1	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	1.23e-100	1	353	1	355	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	4.13e-93	2	345	5	346	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	4.49e-87	2	346	8	359	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1TKD1	5.99e-191	4	354	5	355	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Acidovorax citrulli (strain AAC00-1) OX=397945 GN=murG PE=3 SV=1
Q12EL5	3.46e-186	4	353	32	386	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) OX=296591 GN=murG PE=3 SV=1
A1VST6	1.18e-182	2	353	3	359	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Polaromonas naphthalenivorans (strain CJ2) OX=365044 GN=murG PE=3 SV=1
A1WRL1	8.82e-173	3	354	4	359	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Verminephrobacter eiseniae (strain EF01-2) OX=391735 GN=murG PE=3 SV=1
Q21SW9	1.23e-172	1	352	30	386	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) OX=338969 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004150_00511.