CAZyme Information: MGYG000004144_01350

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales; Monoglobaceae
• CAZyme ID: MGYG000004144_01350
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307		35487.97	4.7244

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004144	1539637	MAG	United Kingdom	Europe

• Gene Location: Start: 83; End: 1006 Strand: +

Full Sequence      

MDYFINDDGTINTYNPTVYNIDHINNGKDCFWLYNKTGEEKYIKAVELLKSQLRTHPRTK
SGAYFHKLIYPNQIWLDGLFMGEPFCAQYAKECGHPEEFDDIVNQFVIAERSTYEPRCGL
YAHACDESREVFWADKNTGRSLNVWGRSCGWFCMAMVDVLDFIPDDHPGRKTLIDMLNKV
LSNVVKYQDESGVWYQVLDNRRSDNYKESTCSCMFAYAMNKGIKYNYIDEATYKPYLEKA
VDGIFNEFIRVDGDYAYLKNCCAVAGLGPADNPRRDGSLDYYFSEPVIENDCKGVGPFLF
LAAEYIY

Enzyme Prediction     

No EC number prediction in MGYG000004144_01350.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	1	305	1.8e-101	0.8614457831325302

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	9.64e-96	1	305	65	353	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	8.56e-89	1	306	58	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUO20415.1	6.55e-219	1	307	60	366
ADL43392.1	9.98e-109	1	299	62	363
ADQ05624.1	1.62e-107	1	299	62	363
AEM73046.1	1.62e-107	1	299	62	363
AEM72744.1	3.73e-105	1	299	47	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	5.59e-96	1	305	54	358	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.82e-61	21	304	87	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.20e-60	21	304	77	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	1.75e-23	58	306	183	411	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	3.68e-16	34	244	122	328	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.54e-60	21	304	87	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	3.13e-42	81	304	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.13e-42	81	304	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	5.22e-20	21	260	73	308	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P9WF04	2.04e-08	32	288	147	402	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004144_01350.