CAZyme Information: MGYG000004135_01290

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Butyricicoccaceae; Agathobaculum
• CAZyme ID: MGYG000004135_01290
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
279		30767.22	9.5469

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004135	1528355	MAG	United Kingdom	Europe

• Gene Location: Start: 1576; End: 2415 Strand: -

Full Sequence      

MLSYGPKLGTFAVNGYAYPNIDVRVLRKTLPYLTYLSIFSYGFDSMGRLLPQNADLLTRM
ARQYGVRPLLVLTTLGEDGQFSGERAHRLFQDTASRSALVENLAQTLAAQGFAGVDIDFE
FVPPEDAAAYAAFVRDVRARLEPAGYTVLVALAPKTSSGQRGLLYEAHDYRAMGAAADYV
LLMTYEWGYALSEPMAVAPLDKVAQVVRYATSVIPPEKIFLGIPNYGYDWTLPFIRPVAR
ADDRERAGRRAGDPGRRTHPVRRNGTVAALQLLARPGRA

Enzyme Prediction     

No EC number prediction in MGYG000004135_01290.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	69	231	2.4e-31	0.48986486486486486

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	2.97e-89	13	251	4	244	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	3.43e-65	13	233	104	329	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd06549	GH18_trifunctional	2.64e-26	68	232	61	216	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
smart00636	Glyco_18	2.95e-22	11	232	9	242	Glyco_18 domain.
pfam00704	Glyco_hydro_18	3.37e-19	79	232	72	229	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ61716.1	6.36e-85	7	243	103	339
BCK83840.1	2.47e-84	7	241	102	336
BBF45454.1	5.22e-84	7	241	103	337
BCJ99370.1	1.47e-83	7	242	103	338
QOX63466.1	1.50e-83	7	242	10	245

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3J_A	2.89e-51	23	241	123	342	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
4S3K_A	2.12e-46	24	234	126	335	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
3CZ8_A	2.09e-39	19	234	19	232	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
4Q6T_A	2.17e-20	40	232	37	242	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]
5JH8_A	8.55e-18	56	233	56	226	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0DPJ9	2.92e-50	4	241	95	341	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	4.10e-50	4	241	95	341	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
P37531	2.88e-45	24	234	122	331	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
O05495	8.50e-38	19	234	111	324	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	1.63e-20	26	230	45	250	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999807	0.000205	0.000004	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004135_01290.