CAZyme Information: MGYG000004132_01832

Basic Information

• Species: V9D3004 sp900760345
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; V9D3004; V9D3004 sp900760345
• CAZyme ID: MGYG000004132_01832
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1132	MGYG000004132_30|CGC1	127016.28	4.7979

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004132	2510246	MAG	United Kingdom	Europe

• Gene Location: Start: 19322; End: 22720 Strand: -

Full Sequence      

MNRKIVAFMLILAIVLGVVNTPQIIAEAKTTSKVKSIKIINPKKASLKLKVGSKFKLKIK
IKPKAASKTKVKYSSSKKKVATVSAKGVIKAKKEGKAKITVKAGKGKKTMKKDTIKVKVV
KNDSGIISVSTPVPSVNTDNPPVFTATPEPALPDGTFTIASKKEAVQLFIDQYVNDYEGL
RLVSECFAEDVKMVSDADLDIVVDNTKLKGSVIIAGSVDNNMLINKLVQEGKLNVDEIRG
KWEVYKIDVVENPFDGVDKALVITGSDKRGTMYGLFSISELMGVSPWVYWADVNPVKKDE
ISFKYSEIRTVSKEPSVKYRGIFLNDEEPSLGTWVNNKFKTTSGGKFNENFYEHVFQLLL
RLKANYMWPAMWNSSFGADGVAFPEASAELADTYGIVMGTSHHEPMMLAHQDWVRNKSKY
GNGQWDWVTNQEGLTKFFTYGATDFGKYDNVCTIGMRGDGDATMLPEGSTVEENVTLLKE
IITAQKNILNEKGLSDKPKMIALYKEVEEYWYGDDETEGLKEWDGLDDTIVLLAEDNYGN
LRTLPTEENRNRAGGWGMYYHFDYNGAPASYQWTQTFQLQKVWEQMSMAYDYGVDDIWIV
NVGDLKPMEMPISYFLDMAYDFDTWGTANIDSADEYENNWLKEQFGNYLTDEEINDVADL
IDEYTRITTLRKPEIVKADTFSLENYNEAMRVLKSINDVKEAADIYKEKLPDEAQAAYYQ
LVYYPAVATTNVIKMQIYSGINKQYFKQGRVSANVYAGLLEESIEFDKELENIYSKNMPG
GVGDKWDGMMAQATNARHVGYDSWKPEGKYPEAQYLNNLPDNPSMLVSVQGESKVHESGS
IDLQEFTSINKEHYYIDIANAGKNPFNYEITTSADWIKVTDTNGTVNTQDTVGVEVDFDS
LSDDATGTLTIKGNSQTVTVNIKANVIDVSGMDNMTYVEAHDYVSIEASHYSEKNAGGTN
AEWKEINNYGRTLSSMKVFPTTTSFDGSDSAPYVEYKFYVDSSEKYSMQTQIAPSNNVDW
NNVTMRFAYSVDNAPLKEVDTITSKYIAGTWRDSTWSNGVRDNIRTITESLGNLSEGVHT
IKIYAVDPAIVLEKLIMYPSSKTLKKSYLGPEESYFVGKNVQSELIADIHEQ

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	156	850	2.8e-205	0.8866571018651362

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	5.77e-171	313	674	1	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	3.11e-56	936	1113	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam19190	BACON_2	1.43e-06	860	920	24	84	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.
cd14948	BACON	3.79e-05	867	923	27	81	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam02368	Big_2	0.003	40	112	3	75	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNU66651.1	0.0	164	1119	45	986
AQR97306.1	0.0	159	1116	6	944
AGF58615.1	0.0	159	1116	6	944
AEY65938.1	0.0	157	1116	7	947
APC42637.1	8.34e-313	168	1119	2	934

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NPS_A	2.85e-226	179	1119	31	968	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
4ZMH_A	4.85e-181	154	1120	11	939	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	6.31e-146	157	818	17	652	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	1.86e-143	157	818	16	651	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4C90_A	9.03e-129	157	1114	44	849	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000323	0.999063	0.000165	0.000159	0.000143	0.000135

TMHMM  Annotations     

start	end
5	27