CAZyme Information: MGYG000004129_00655

Basic Information

• Species: Acutalibacter sp000435395
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter sp000435395
• CAZyme ID: MGYG000004129_00655
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase/feruloyl esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395		44291.45	5.0423

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004129	2343469	MAG	United Kingdom	Europe

• Gene Location: Start: 66526; End: 67713 Strand: -

Full Sequence      

MANLEQFPSAALNGAYYDTPVAFEPQLPMGRPAGTNPFADSDTVVPPGAVLLEGGKLRLN
FLAPTAAKVDAVLRYRERHDLEKGENGLWTAEIDAGDGGFIPILFHVDGVEVLNPLAPVG
YGSSRPINYVDVPQPGVDFYLCKDVPHGTVTQDYYFAPSVGLLKSCLVYTPAGYMKDDTQ
TYPVLYLQHGHGENEKCWVHQGRANFILDNLIAEGKMPPCVVVMNNGMVQREQEGLRVLE
TNAITRLLLEDCIPYIQSHYRVRTDKWSRAMAGLSMGSMQTSMVTLGHPDLFGYAGVFSG
FVGALKIGQSMPDQSYLKELDDKEKFQQDFKVFFRGCGDTDYIALDRFEKDRELFREKGL
APEDCPAHVEKIYHGEHEWNVWRMCLRDFCQLLFR

Enzyme Prediction     

No EC number prediction in MGYG000004129_00655.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	165	389	1.3e-45	0.9251101321585903

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	9.24e-24	132	395	54	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd02858	E_set_Esterase_N	1.89e-15	55	133	1	78	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam00756	Esterase	2.15e-15	168	383	12	236	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	3.59e-07	168	302	39	187	S-formylglutathione hydrolase FrmB [Defense mechanisms].
cd11294	E_set_Esterase_like_N	9.84e-06	55	133	1	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK94454.1	1.11e-90	37	395	18	368
CBK90399.1	6.27e-90	37	395	18	368
QUC66034.1	2.63e-86	48	395	27	361
VCV24180.1	4.93e-70	47	394	434	770
CBL10138.1	4.93e-70	47	394	434	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZO_A	2.26e-65	55	395	23	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
6RZO_B	2.33e-65	55	395	23	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	1.55e-63	51	395	42	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6MOT_A	3.29e-62	53	395	23	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOU_A	5.93e-62	53	395	44	380	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EY13	8.59e-53	28	395	386	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
D5EXZ4	7.13e-43	55	395	335	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
P31471	1.47e-31	61	395	53	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P10478	3.81e-28	119	392	21	275	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
P51584	6.18e-08	118	356	795	1032	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004129_00655.