CAZyme Information: MGYG000004120_00099

Basic Information

• Species: CAG-822 sp900546055
• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-822; CAG-822 sp900546055
• CAZyme ID: MGYG000004120_00099
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
843	MGYG000004120_1|CGC2	92847.52	6.5901

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004120	1446947	MAG	United Kingdom	Europe

• Gene Location: Start: 94503; End: 97034 Strand: +

Full Sequence      

MKKLICLLPFLSIFFICMGSVDAAPALADGEYKIKSAVSNNMVMTIEGGDFTKPSNVNLE
NDNNLKTQRWNVKHLGNDYYVISSSAASYAVLDVKGAGKINKTNVQIYGYNNSSAQKWLV
KYAGNGYYYVISNCNNLYLDVDGAKNYNGVNLHMYQGNGTSAQMFKFVPIVDPKQSLPDG
SYTISTALNNNSVLDLTSGRTENSTNVQLYSSNDSWAQIWDVKYLNNGYYSITSHLNSEK
SLDVSGAKSMNSANVQLYQSNGTDAQQWILKDLGNGYYNIVSKLDNLFLDISGAKYTNGT
NVQLYHTNGTSAQKFKFNKVEFNMLSDGLYMINSALNSNKVVGLDKEVSVNNANVQLETN
ANLNSQKWWVKYIGSGYYTIQTALDDSKAIDVPGAKTYDGANVQLYASNGSKAQKWIIKY
LGGNQYSIVSALDGRHVDVKSGQTAEGTNIQLYSSNGTNAQKFTFTPTEKSGQGHSYEDG
YYTISTSINTSMVLDVSAGAKYNGVNVQLYKSNNSNAQVWYLKYLNNGFYSIASSINPDL
VLDVASGGMVSGTNVQMYRFNNSDSQQWMIRDLGDGNVSLVSKINGLSLDVTNGTLVNGA
NIQVANSNGGNGQKFKLSKNTNNKVYTGIDVSYHQGNIDWEKIAKSDLGFVIIRAGYGGD
WNDQDDLMFAANVSACEKYNIPYGLYLYSYASDIDNANGTGAVSEAKHMLRLINLIKANN
YHPNLGTKVFLDVEDKSVANVGKEKLTLVADKFCSTIENNGYSCGIYANKMWLTDKLDSV
ALSKKYEIWLAEWPNGVNTFAQAMNTRPTYNLTPYKYWQFASDGNINGISTNVDMDLGYN
IFE

Enzyme Prediction     

No EC number prediction in MGYG000004120_00099.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	629	829	1.9e-36	0.9943502824858758
CBM13	181	323	7.6e-24	0.7074468085106383
CBM13	328	475	1e-21	0.7340425531914894
CBM13	29	190	6.1e-18	0.8351063829787234
CBM13	478	571	6.5e-17	0.4734042553191489

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	3.37e-59	628	839	3	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	8.23e-25	628	837	2	185	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam14200	RicinB_lectin_2	9.12e-23	217	305	2	89	Ricin-type beta-trefoil lectin domain-like.
pfam14200	RicinB_lectin_2	7.73e-20	364	453	1	89	Ricin-type beta-trefoil lectin domain-like.
pfam14200	RicinB_lectin_2	8.39e-19	68	155	3	89	Ricin-type beta-trefoil lectin domain-like.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCP36075.1	1.99e-34	628	837	99	284
BAK44097.1	6.42e-34	614	839	614	824
CAB1243797.1	5.03e-33	628	842	5	198
BCA89043.1	1.10e-32	628	842	213	419
QHJ73726.1	9.24e-32	627	842	3	193

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WW5_A	3.33e-16	629	839	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
2WWC_A	7.80e-16	629	839	272	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]
4KRU_A	1.26e-07	628	836	22	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	3.21e-07	628	836	22	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000278	0.999031	0.000234	0.000152	0.000143	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004120_00099.