CAZyme Information: MGYG000004106_00838

Basic Information

• Species: UBA5905 sp004558485
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA5905; UBA5905 sp004558485
• CAZyme ID: MGYG000004106_00838
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1020	MGYG000004106_9|CGC1	111440.78	5.3816

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004106	1798758	MAG	United Kingdom	Europe

• Gene Location: Start: 36434; End: 39496 Strand: -

Full Sequence      

MDLHEEKRKTWRALSQTIAEEGFVLLRNENGVLPLGGECVAVFGQAQCAARPATHPDLTF
TEGLMAGGIRVEETLLKKYRTFAEKKAQKRRYTASFFTGMDNEMPITREEIAASRAAGAK
KAIVILKRISAENTDMQVTEGDYLLSAAEKQMLTDVAAVFEHVILVLEIGCVMDLSFLDE
IRVEGILYTNDLGDGGAAAATRVLKGEVNPSGKLPMTMARSYEEYPTCGHFGQHGGGLVQ
DYTEDIFVGYRYFDTFGGNVAFPFGFGLSYTTFAVSDVHFEDGKVLRVTAAVTNTGARAG
REVLQLYCAAPALRDGAKLGKPQKELRGFEKTRLLQPGEKQTLSIAVPVSELASYDDTGV
LGEKSVWVLEKGSYTLLLGTDSRHVHEAGVHFEPQTRVVRHSMPLTTTLEKRLTADGSYE
PLASQTDDGAHCIAVSSIERTVITAGAKLHFSAMKNGEQVQRQLLPGTGGGYRLTAVDGD
GTPLESMIALAIDGVSMPLHSDAAGVAEITLPVRRCQMTVTALCDHPALAALAFEKTDTT
VPVLPEKKTVIKGQNYYEGSFYVEVESFEDDGNGVPGSCVTHFFMSGMSVVYRVNIAEAG
NYAVKFRYRYDGTETVMNSVLTLAVSNIVQPLRGMALENTCKDGKKRFIYSNAAVIELPQ
GVAYLKLLAEAVPFPDICEIVLEKTNDAVDATTQQEDVKVKESKGGGLQYLKPDDGIREG
ITLADVAKDGTGMQAFLAQLSNRELATLVSGTSLNRTPYGDVGCNHPLYLRGVPAAQTAD
GPRGLRQRGLATTLYPPTLILTASFDKDLYTTYGTAMGEECLFCGVDLWLAPAINIFRDP
CGGRNFAYSSEDPYLCGVYAAAVIRAAQACGIGAVLKHYCANNTEFERLKSNSRVSERAL
RELYIRAFETVVRDADPVAIMSSYNHVNDIKACENRELITDIPRREWHWDGVFMTDWWND
SDHVAELKAGHDLKMATGDIDGVTAALDKGDLSREEVYPCAARVMRMLLRLKTAQEFLRK

Enzyme Prediction     

No EC number prediction in MGYG000004106_00838.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	772	975	1.9e-54	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	4.03e-36	772	1018	59	315	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	5.56e-34	12	393	384	763	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	6.71e-25	24	250	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	3.22e-22	772	1007	65	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	2.48e-21	791	997	110	352	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF25491.1	9.41e-112	13	1012	30	802
QTE71631.1	1.81e-110	13	1011	30	800
QTE75591.1	1.81e-110	13	1011	30	800
QUC67637.1	3.51e-110	14	1011	31	800
AHF26140.1	5.01e-110	13	1012	30	802

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	1.80e-94	15	1009	40	820	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X40_A	2.41e-51	737	1009	8	305	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.56e-50	737	1009	8	305	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	1.16e-49	740	975	12	251	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
7MS2_A	5.67e-45	733	1008	5	286	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16084	7.25e-101	14	997	31	810	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
P15885	6.86e-86	11	1009	6	763	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
E7CY69	4.02e-47	740	975	12	251	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	1.72e-46	740	975	12	251	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
P14002	3.11e-44	733	1008	5	286	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004106_00838.