CAZyme Information: MGYG000004095_00709

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Dialisteraceae; UBA1822
• CAZyme ID: MGYG000004095_00709
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
505	MGYG000004095_6|CGC1	57441.59	8.1211

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004095	1534718	MAG	United Kingdom	Europe

• Gene Location: Start: 44762; End: 46279 Strand: +

Full Sequence      

MTSDRKYLFVYCLILFLLFLWNVPLLDPDEPVYGETAKEMLATGDWLSPRIYGEFWYDKP
PLFYWLEALSFSVLGVSTFSARLPSALIAALTVLYVWHETEQLFSRRTAFLAALILATSL
EFVVIARSAVTDMTLTAALTVALFSFVRERYVTAYIACGLALLAKGPIGFGFPALIVGLW
LLAQRQFTFRRVMALKWYWGIPLACAVGLPWYLYMTAVHGQPFIDTFLGYHNLVRFTEPE
HAGKDHWWLYLVVLTAGCFPWTGAMCGMLTRLRRFASDPVKLYFIVWAAFIFLFFSASST
QLFSYILPMYPALAVLTALYLEELLDRPPGRLFPQLHIFFLGLTTAAVGLAPLTPAGGDT
VRYGTAFVLLLLGLAGARAYRWGRPKLFLLLQGALPLFLVCAVWTLFAAPVREQFTSPDL
SLKVLLTERDEGVPLYIDPFYRPASAFYHDLYGLRMPDLRQPAEDIPGDAYLLVQKKLCR
DWPDEERARWRTVWETPAAYFLRKS

Enzyme Prediction     

No EC number prediction in MGYG000004095_00709.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	7	448	2.9e-111	0.8537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.56e-51	8	449	13	472	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	3.95e-40	1	333	2	345	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	1.62e-16	58	187	1	138	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	5.90e-16	8	214	3	233	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	5.57e-05	17	247	27	281	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK24580.1	4.67e-196	8	504	10	527
AOH39317.1	1.14e-172	1	504	1	527
ALG41392.1	1.22e-111	14	477	20	478
AVO73979.1	9.66e-111	14	477	20	478
CCC72524.1	9.66e-111	14	477	20	478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	8.78e-31	25	403	54	444	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6D2F3	5.00e-33	27	355	32	375	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnT PE=3 SV=1
C6DAW3	6.80e-33	27	355	32	375	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=arnT PE=3 SV=1
B4EUL1	2.16e-32	1	332	5	344	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Proteus mirabilis (strain HI4320) OX=529507 GN=arnT1 PE=3 SV=1
C5BDQ8	3.04e-32	27	324	29	335	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
O67270	8.33e-32	28	323	28	323	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000022	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	26
78	97
109	131
151	182
195	217
247	269
282	299
303	325
332	351
361	380
387	409