CAZyme Information: MGYG000004075_00448

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1591
• CAZyme ID: MGYG000004075_00448
• CAZy Family: CE2
• CAZyme Description: Cellulase/esterase CelE

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		41553.33	4.2499

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004075	2841804	MAG	United Kingdom	Europe

• Gene Location: Start: 59482; End: 60663 Strand: -

Full Sequence      

MSKTKLIALLGGLGCVLAAAVICLVVLLTGDAGKVQPAGSSDVTADSAPEAPAPESPGSE
EEKPVERPLTGDPVTYIGRFKALSDGRMRCSWSNSTVVAGFEGTGIAVNLSSSAGEDYVN
VSVDDGEPVVLAITNRTERYVLAEGLEPGIHYVRIAKRLEGSKSYLTFSGFDYLDGTAAP
TPAPRERRIEVIGDSITAGYGNEGPDDWSGFKNVEENAGITYGALAAESLDAEATIIGWS
GMGLHQDLGGGTTLLMPEIYQRTIGTASAADWDFRQNIPDAVVVNLGTNDFASSVDPKAF
EASYVEFIHFIREKYPDAAILCVIGTIRYDAWNAIKSAVETVNGEGDANVYSFAFTPAST
LGEPNGTDGHPSAQTHARMAEELSGEIRRICGW

Enzyme Prediction     

No EC number prediction in MGYG000004075_00448.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	188	387	4.4e-61	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01831	Endoglucanase_E_like	4.01e-40	188	388	1	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
pfam17996	CE2_N	3.44e-27	76	184	1	108	Carbohydrate esterase 2 N-terminal. This is the N-terminal beta-sheet domain with jelly roll topology found in CE2 acetyl-esterase from the bacterium Clostridium thermocellum. This enzyme displays dual activities, it catalyses the deacetylation of plant polysaccharides and also potentiates the activity of its appended cellulase catalytic module through its noncatalytic cellulose binding function. This N-terminal jelly-roll domain appears to extend the substrate/cellulose binding cleft of the catalytic domain in C.thermocellum.
cd00229	SGNH_hydrolase	3.16e-14	189	383	1	184	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
pfam13472	Lipase_GDSL_2	7.69e-13	191	378	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
COG2755	TesA	7.22e-07	179	390	1	211	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADZ19589.1	9.12e-69	70	393	37	365
AEI33836.1	9.12e-69	70	393	37	365
AWV80238.1	9.12e-69	70	393	37	365
AAK78516.1	9.12e-69	70	393	37	365
ACL76504.1	1.35e-66	64	393	102	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAO_A	2.60e-62	74	393	11	333	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	7.25e-62	74	393	11	333	ChainA, ENDOGLUCANASE E [Acetivibrio thermocellus]
4XVH_A	9.26e-45	74	393	2	329	Crystalstructure of a Corynascus thermopiles (Myceliophthora fergusii) carbohydrate esterase family 2 (CE2) enzyme plus carbohydrate binding domain (CBD) [Chaetomium]
2WAA_A	3.39e-34	74	393	20	339	Structureof a family two carbohydrate esterase from Cellvibrio japonicus [Cellvibrio japonicus]
2W9X_A	7.53e-20	73	392	29	358	Theactive site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus],2W9X_B The active site of a carbohydrate esterase displays divergent catalytic and non-catalytic binding functions [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10477	9.53e-58	74	393	492	814	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
B3PIB0	2.29e-33	74	393	39	358	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=axe2C PE=1 SV=1
B3PDE5	3.88e-19	73	392	29	358	Acetylxylan esterase / glucomannan deacetylase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ce2C PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000017	0.000012	0.000002	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
7	29