CAZyme Information: MGYG000004037_00863

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471
• CAZyme ID: MGYG000004037_00863
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
468		51358.45	4.757

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004037	2199612	MAG	United Kingdom	Europe

• Gene Location: Start: 36850; End: 38256 Strand: -

Full Sequence      

MKNIVISLFFICLSSTSMADNIPFSHPAHLFDASNSNTLGLSEAPGSETITVFAPSDETD
HFSNGVVMIAFKGALYCMWQSSQTDEDAADTWVAYSRSLDEGKTWSAPIVLAEDIENGYC
SSGGWHATADTLVAYINTWPDNLSPKEGYTRYITSTDGINWSAPADVTMADGARIEGIFE
QDPHVLPNGRIVNAMHKQPGLKVMPIYTDDPLGVRGWKEGAFTFTNKGEQSRELEPSLYW
KPDGTLVMIFRDQNSTYLKMAATSTDNGETWSDAVLTDFPDARTKQSAGNLPDGTAYFAG
NPVNNKTRIPLVLTLSKDGNVFDTAYLLRSNDEMPQLRYEGSAKRAGYHYPKSMVYNDYL
YVAYATNKEDVQYTRVPLSSISLNGSGGITAATTPDTEVILSGNELCIRLASESYMEIEV
YNVSGHCVARFEAYGKVSRHDTSALAKGVYVVRVITAQKVTSHAVIIK

Enzyme Prediction     

No EC number prediction in MGYG000004037_00863.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	65	344	3.3e-23	0.7953216374269005

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	3.18e-56	73	362	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	2.88e-27	51	377	2	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
TIGR04183	Por_Secre_tail	1.18e-06	402	468	7	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
COG4692	COG4692	2.87e-04	234	377	241	372	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam18962	Por_Secre_tail	5.56e-04	412	467	15	72	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ79596.1	2.01e-127	27	378	348	701
QDU80203.1	9.42e-24	52	382	69	397
QNN22017.1	1.61e-18	73	381	260	566
QDT41634.1	7.24e-18	45	383	263	591
QDT90248.1	1.70e-16	62	386	280	594

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002788	0.995775	0.000326	0.000396	0.000358	0.000333

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004037_00863.