CAZyme Information: MGYG000004017_00894

Basic Information

• Species: HGM11588 sp900754755
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; HGM11588; HGM11588 sp900754755
• CAZyme ID: MGYG000004017_00894
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
190	MGYG000004017_13|CGC2	21284.28	7.3088

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004017	3620670	MAG	United Kingdom	Europe

• Gene Location: Start: 36815; End: 37387 Strand: +

Full Sequence      

MAKTRKKRPLLRAALLLAAVAVIGTLFFPNWLRQLQYPMKLESLVRETAAEYGLNPPLVA
AVIYTESKYNASAVSSAGAMGLMQIMPETGEWIAHKLDWPFTDETLFDPRANARLGAWYL
RFLLDRYDGRVQNAIAAYHAGQGSVDAWLEDARYSSDGLTLERAGSSSTQHYINKVLSAY
ENYQILYEAS

Enzyme Prediction     

No EC number prediction in MGYG000004017_00894.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	54	184	1.4e-32	0.8222222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.62e-66	38	181	1	145	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.85e-44	37	186	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	4.30e-38	56	181	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.23e-29	45	149	1	103	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	5.83e-29	32	187	130	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT54455.1	5.14e-47	5	187	21	206
AIS52076.1	1.15e-45	37	187	31	182
ADV80073.1	3.28e-45	37	188	31	183
ABY95122.1	5.12e-45	37	188	46	198
ABY93426.1	5.12e-45	37	188	46	198

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.67e-13	33	189	404	561	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.68e-13	33	189	408	565	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.69e-13	33	189	414	571	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.69e-13	33	189	418	575	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.70e-13	33	189	424	581	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	7.31e-23	41	180	60	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	3.90e-17	37	180	1418	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	3.90e-17	37	180	1418	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
Q1CB94	4.88e-14	40	184	190	356	Membrane-bound lytic murein transglycosylase C OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=mltC PE=3 SV=2
B2K0V2	4.88e-14	40	184	190	356	Membrane-bound lytic murein transglycosylase C OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997933	0.001172	0.000108	0.000004	0.000003	0.000818

TMHMM  Annotations     

start	end
13	32