CAZyme Information: MGYG000004013_00900

Basic Information

• Species: Collinsella aerofaciens_F
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella aerofaciens_F
• CAZyme ID: MGYG000004013_00900
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	MGYG000004013_90|CGC1	35005.7	7.7448

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004013	1826478	MAG	United Kingdom	Europe

• Gene Location: Start: 3711; End: 4625 Strand: +

Full Sequence      

MPFPKGFLWGGATAANQCEGGYDEGGRGLANVDVIPHGPERNDVSRGLRRMLDFEPGYYY
PAQTGIDFYHHYREDIALFAEMGFKVFRLSIAWSRIFPNGDEEEPNEAGLAFYEDVFRCC
REHGIEPLVTITHFDCPIHLVKKYGAWRNRTLIELYKRLVTVLFNRYRGLVRWWITFNEM
NMILHRPFMGAGIVLEPGENAREAEYRAAHNELVASAWATKIAHEVDPENKVGCMLAAGS
YYPYSCRPEDVRAAQVKNQEDLFFVDVQARGRYPGYARARGHRRGHDRRGRAHPCGEHRR
LHLV

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	280	4.2e-88	0.6013986013986014

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09593	arb	1.76e-174	1	278	4	281	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	1.02e-154	3	278	4	279	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	7.56e-125	1	277	2	265	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	3.76e-115	1	276	2	278	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	1.54e-100	1	276	4	280	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA32972.1	6.39e-210	1	277	1	277
AZH68819.1	1.27e-164	1	287	1	287
QWT17213.1	1.00e-163	1	277	1	277
AEB07701.1	2.92e-158	1	287	1	287
QPS13317.1	2.15e-155	1	277	1	277

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	6.81e-103	3	276	8	272	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
3QOM_A	1.44e-93	3	280	11	289	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
2XHY_A	1.08e-92	1	285	6	291	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F79_A	3.53e-91	4	274	8	279	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
4F66_A	3.53e-91	4	274	8	279	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	4.93e-125	3	277	4	278	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	1.40e-107	3	276	8	272	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	1.24e-95	1	276	5	271	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q46829	5.93e-92	1	285	6	291	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P11988	4.63e-89	3	276	4	266	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000011	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004013_00900.