CAZyme Information: MGYG000004010_00976

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; QALW01; UMGS1322
• CAZyme ID: MGYG000004010_00976
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		45399.51	5.4887

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004010	1960266	MAG	United Kingdom	Europe

• Gene Location: Start: 23040; End: 24248 Strand: +

Full Sequence      

MNVAIVGYGQRASDLVPNVLTKLKDVNFVSVCDKYPDRAEKAKADLEKYGFSPKAFTDYR
EALSVSGLDAVLVLSSWDNHCEVALYAMEKGIAVGSEVGCEYSLENCFELVRTHERTKTP
YMFMENCCFGEEELLATSLVRRGMLGSIVSCSGAYGHDLRHEIAYGHKNRHYRFDNYKTR
CLENYPTHELGPISRLLNINRGNRIVSVMSVASKAAGLKEYIASRPDADEDMKSTEFMQG
DIVETLIKCANGELIRLTLDTTLPRSYSRAFTVRGTKGAYFMDTDSFFFDGDKEFWLPTD
FAKEYMGNAKKYEALRPEIWRNVTQEDREHGHGGMDLFCYGAFIDALKNNKPMPIDVYDG
AVWQAVSVLSEQSILKNSVEIMPDFTHGAYLTRKSEDVVPLF

Enzyme Prediction     

No EC number prediction in MGYG000004010_00976.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	391	2.9e-113	0.9774436090225563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.58e-19	1	374	4	332	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	3.15e-10	1	122	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTH43530.1	8.11e-129	1	394	5	399
QUO31207.1	1.09e-123	1	393	4	398
ALS29040.1	4.18e-122	1	394	5	399
QTH41319.1	8.25e-120	1	394	8	401
QJD87109.1	2.64e-119	1	394	5	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	7.21e-73	1	395	21	436	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	5.42e-51	1	401	43	449	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	3.95e-72	1	395	21	436	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	4.34e-70	1	394	34	445	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8G1	1.22e-69	6	394	58	463	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	1.22e-64	6	396	55	463	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
B1KNF7	1.17e-60	1	399	57	465	Glycosyl hydrolase family 109 protein OS=Shewanella woodyi (strain ATCC 51908 / MS32) OX=392500 GN=Swoo_1749 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004010_00976.