CAZyme Information: MGYG000004006_01468

Basic Information

• Species: Alistipes sp000434235
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp000434235
• CAZyme ID: MGYG000004006_01468
• CAZy Family: GH171
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424	MGYG000004006_5|CGC3	46071.88	8.5461

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004006	2755781	MAG	United Kingdom	Europe

• Gene Location: Start: 182830; End: 184104 Strand: +

Full Sequence      

MAPRRKGFPAVRRLRSALRSGIGIGGVSRAAVRRIACAVLWLLPGFASAEVLVGMTDTAA
YFPRLAGRRVAVLANQTSVADMPGAPGADASGRVHLVDLLHARGFDVTGIFSPEHGFRGT
ADAGEHVGSTVDARTGIPIRSLYDGGSGRPSDEAMRSFDILLIDLQDVGLRFYTYYITML
RLTDACADAGREVIVLDRPNPNGDKVEGPLLDMKYRSGVGQLPIPVLHGMTLGEIARMAI
GEGWAHPCRLDVVPCRNYTHATEYLLPVAPSPNLPTQRSVYLYAALCPFEGTVVSLGRGT
DRPFACYGHPGLKGRNYTFTPRPTAGAKHPPLEGEVCRGVDLSSLPLDEARATGFTLRYV
IDAYRDLEALGDAFFTPMFEKLVGAGWVRGMIRAGATDAEIRARWQEDVARFRPLRAKYL
LYEE

Enzyme Prediction     

No EC number prediction in MGYG000004006_01468.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH171	70	422	7e-104	0.9971830985915493

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07075	DUF1343	5.81e-157	71	422	1	362	Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
COG3876	YbbC	2.13e-81	61	422	37	409	Uncharacterized conserved protein YbbC, DUF1343 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL06023.1	1.49e-232	33	423	3	396
BBL01800.1	1.26e-205	47	423	18	405
BBL12464.1	2.53e-205	47	423	18	405
BBL09670.1	2.53e-205	47	423	18	405
AMP51471.1	2.53e-205	47	423	18	405

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4JJA_A	1.46e-144	50	424	5	370	Crystalstructure of a DUF1343 family protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution [Bacteroides fragilis NCTC 9343]
4K05_A	9.34e-40	62	423	25	399	Crystalstructure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343],4K05_B Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40407	1.32e-63	61	422	48	414	Uncharacterized protein YbbC OS=Bacillus subtilis (strain 168) OX=224308 GN=ybbC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.514315	0.385175	0.096368	0.002173	0.001151	0.000817

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004006_01468.