CAZyme Information: MGYG000004003_04260

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_04260
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		44315.27	6.2495

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 3575; End: 4717 Strand: +

Full Sequence      

MKKSLFSFFTVTLLFCLTTVNPAAAQELPAQKETLETIIKVNDYFMKKYADYTIPSFYGR
VRPSNIWTRGVYYEGLMSLYSIYPREDYYRYAYDWADFHKWGMRNGNTTRNADDHCCGQT
YIDLYNICPSDPNMIRNIKASIDMVVNTPQVNDWWWIDAVQMAMPIFAKFGKMTGEQKYY
DKMWDMYYYTRSQHDETGMFNQKDGLWWRDQDFNPPYKEPNGEDCYWSRGNGWVYAALVR
VLDEIPADEKHRQDYINDFLAMSKALKKCQREDGFWNVSLHDPTNFGGKETSGTALFVYG
MVWGVRNGLLDRKEYLPIALKAWNAMVKDAVHPNGFLGYVQGTGKEPKDGQPVTYKSVPD
FEDYGVGCFLLAGTEIYKLK

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	62	378	2.9e-94	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.83e-118	37	380	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	5.73e-53	45	379	11	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU94559.1	4.96e-298	1	380	1	380
QNL41144.1	2.62e-284	1	380	1	380
ALJ49013.1	1.07e-283	1	380	1	380
QRQ55821.1	1.07e-283	1	380	1	380
QUT83154.1	1.07e-283	1	380	1	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	8.07e-72	1	375	1	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	3.99e-66	32	375	14	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	2.69e-49	61	380	48	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
4WU0_A	1.97e-14	137	379	101	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	2.66e-52	67	380	58	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	1.73e-48	61	380	55	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	3.55e-36	111	376	135	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000234	0.999028	0.000242	0.000165	0.000147	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_04260.