CAZyme Information: MGYG000003994_01256

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471
• CAZyme ID: MGYG000003994_01256
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464	MGYG000003994_45|CGC1	50126.64	4.6612

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003994	2451435	MAG	United Kingdom	Europe

• Gene Location: Start: 6075; End: 7469 Strand: +

Full Sequence      

MWALLLSLLVSVPAYAEGLLAFPGAEGFGRFATGGRGGTIYHVTNLNDSGTGSFRDAVSQ
SNRIIVFDVSGVIHLKSPLIFKSNLTVLGQTAPGEGVQVYGDRVSFSGANNIIVRYIRFR
MGVGGTSGADACGVSNGKNMIFDHLSVLWGRDECFSVSWDNKGTMPSDITIQNSIIGQGL
QSHSCGGLIQTEGGVTLYRNLYIENKTRNPKVKGLNQFVNNVVYNWGGGGCYIMGDSEGP
SWAHIENNYFMKGPWNGTAPFTRGNSNFKYYAAGNYYDTDKDGVANGREVTESEYTSSGS
SRVYDLETFDGITTRPKAHPTIVGMMSAEEALRWIIDSVGPCLPVRDEVDQYLIDELTSF
GTKGSTNGISSEKDLPHGGTGTLYGGNKPLDSDGDGIPDEWEIANGLNPNDPSDAAAIAA
NGYANIENYVFTITSAYPYIKTPSDLTATAEERVDYSFLDRQFR

Enzyme Prediction     

No EC number prediction in MGYG000003994_01256.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	70	250	1.2e-52	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00656	Amb_all	2.37e-07	68	254	1	190	Amb_all domain.
COG3866	PelB	7.73e-07	33	305	49	322	Pectate lyase [Carbohydrate transport and metabolism].
pfam18884	TSP3_bac	1.42e-04	391	412	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD38445.1	6.12e-214	6	443	14	474
QCP72135.1	1.10e-207	6	443	14	474
QUT90499.1	5.42e-174	10	433	29	462
ALJ58382.1	2.05e-171	10	433	29	462
QUT73817.1	1.63e-170	3	446	8	475

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1DPF0	5.77e-141	8	427	7	408	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
Q4WL88	2.66e-139	8	427	7	408	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B0XMA2	3.77e-139	8	427	7	408	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
B8NQQ7	1.18e-137	10	427	11	407	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q2UB83	2.72e-136	10	427	11	407	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000441	0.998720	0.000213	0.000205	0.000196	0.000187

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003994_01256.