CAZyme Information: MGYG000003989_00071

Basic Information

• Species: Alistipes sp002161445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp002161445
• CAZyme ID: MGYG000003989_00071
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405	MGYG000003989_2|CGC1	46510.04	6.0978

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003989	2451831	MAG	United Kingdom	Europe

• Gene Location: Start: 47970; End: 49187 Strand: -

Full Sequence      

MKPLLIFCLAVLISWTGYAAGDETLLRRVADKVLADYRIAYTDRASGRTYASVDEIPAGA
RVRIASKYMDWHYSLGVLNMALLKMADRFGEERYADFVEQQIDYALSVYDRFGVEEGEDH
EPYHFLRKFNELDHCGAECAAMIELMARRPEKTAAYMPFVTRAAEHIRRVQARFPDGTLV
RTWPYRHTLWADDLYMGLSFMSRYGSRFDDREMLRDAARQVERFHHYLWDPVTELLWHGY
YGDLNRTAGAHWGRCNGWVMLATCQLLDLLPAELCRPVLDLLERQIAGVAKRQAASGLWR
QVLDREDSYEEGSCSAIFVYCVAHAVCEGWIDSRYATVALRGWEGLRREKITPEGELRDV
CVGTGIGTDLPFYYNRPKVDGETHGTGLLLEAGMEILRLNDKLQK

Enzyme Prediction     

No EC number prediction in MGYG000003989_00071.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	67	398	3e-78	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.71e-57	71	399	27	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	4.32e-46	70	399	33	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB51172.1	1.46e-120	21	400	15	398
AFN73321.1	1.07e-115	1	404	1	413
QIK54911.1	1.32e-105	22	405	26	413
AKD05935.1	5.97e-105	19	404	21	417
QRX63314.1	5.27e-104	22	402	25	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	5.45e-55	18	399	40	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	7.36e-25	52	396	29	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.09e-24	52	396	19	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	6.34e-23	146	377	118	358	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.18e-20	146	377	119	359	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	4.03e-24	52	396	29	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	4.07e-12	196	399	1	231	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	4.07e-12	196	399	1	231	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000321	0.999025	0.000189	0.000153	0.000149	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003989_00071.