CAZyme Information: MGYG000003952_00578

Basic Information

• Species: Alistipes sp900021155
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900021155
• CAZyme ID: MGYG000003952_00578
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227	MGYG000003952_2|CGC2	25491.85	7.3518

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003952	2320359	MAG	United Kingdom	Europe

• Gene Location: Start: 279353; End: 280036 Strand: -

Full Sequence      

MLKKTALIFAFLTVFTAFHSFNADFAAPADAFAVEADDHSLLSEGEYVISAYDNIIRSVS
EREGNDWRLLSAIAYHESRFTPDAVSGRGARGLMQIMPVVARQFEVPADAVADPATNVWL
ANRLLKKIDTTLRFARNVPERDRMSIVLASYNGGIGHVSDARRLAGLYGENPDSWEVVAR
YLELKADSAYYENEAVKYGKFTGSRQTIAYVRDVMGRYDKYCRIARR

Enzyme Prediction     

No EC number prediction in MGYG000003952_00578.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	61	221	5.5e-22	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	4.06e-61	56	223	1	161	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG4623	MltF	5.95e-27	66	214	283	424	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
PRK10859	PRK10859	1.28e-24	63	218	299	446	membrane-bound lytic murein transglycosylase MltF.
cd13401	Slt70-like	2.54e-21	51	175	5	126	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	7.46e-20	56	166	1	107	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL08197.1	4.65e-111	1	227	1	232
BBL10988.1	4.65e-111	1	227	1	232
BBL00117.1	4.65e-111	1	227	1	232
CBK65133.1	1.24e-110	1	227	1	230
AFL78639.1	4.80e-108	1	225	1	228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AA4_B	4.39e-17	52	219	252	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	4.39e-17	52	219	252	412	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA2_B	4.81e-17	52	219	300	460	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA2_A	4.81e-17	52	219	300	460	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013],5AA2_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA2_D	4.81e-17	52	219	300	460	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0VRG6	5.21e-25	52	219	288	448	Membrane-bound lytic murein transglycosylase F OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) OX=393595 GN=mltF PE=3 SV=1
A1U3J1	7.12e-23	52	224	286	451	Membrane-bound lytic murein transglycosylase F OS=Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8) OX=351348 GN=mltF PE=3 SV=1
A3QCH2	2.42e-20	66	219	292	438	Membrane-bound lytic murein transglycosylase F OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) OX=323850 GN=mltF PE=3 SV=1
A8H256	1.16e-19	63	219	289	438	Membrane-bound lytic murein transglycosylase F OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=mltF PE=3 SV=1
P44587	2.17e-19	66	224	301	455	Membrane-bound lytic murein transglycosylase F OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000296	0.999004	0.000177	0.000179	0.000167	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003952_00578.