CAZyme Information: MGYG000003936_00416

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; V9D3004
• CAZyme ID: MGYG000003936_00416
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
848		96204.86	4.2924

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003936	1259772	MAG	United Kingdom	Europe

• Gene Location: Start: 26; End: 2572 Strand: +

Full Sequence      

MYGLFSISELMGVSPWVYWADVKPVHKDTVEFKYSELRTVSKEPSVKYRGIFLNDEEPSL
GTWVNNKFKTTSVGKFNENFYEHVFQLLLRLKANYMWPAMWNSSFGADGADFPEASAELA
DTYGIVMGTSHHEPMMLAHQDWSRNKSKYGNGQWDWVTNQEGLTKFFTYGATNFGKYDNV
CTIGMRGDGDSTMLPEGSTVEENVTLLKEIITAQKNILNENGLSDKPKMIALYKEVEEYW
YGDDETAGLKEWDGLDDTIVLLAEDNYGNLRTLPTEENRNRAGGWGMYYHFDYNGAPASY
QWTQTFQLQKVWEQMSMAYDYGVDDIWIVNVGDLKPMEMPISYFLDMAYDFDTWGTANIE
SADQYERNWLKEQFGTYLTDDEINDVADLLDTYTRITTFRKPEIVNTTTYSLENYNEAMR
VLDLIDAVKEKADIYKEKLPESAQAAYYQLVYYPAVATTNVVKMQIYSAINKKYASEGRA
SANVYAKLVDESIAFDKELENIYSKNMPGGVGDKWDGMMAQATDARHVGYDTWKPQGAYP
VAEYLDNIQEEASMLVGAWGESKVYKSGSIDLTEFTSINNENYYIDIANAGSEPFDYEVT
ASSDWIKVTKNSGKVSEQDTIGVSVDFSKLTDDAEGTLTIKGNGQTVTVNITANVISTEG
LDTMTYVEAHDYVSIEASHYASKGSYYEGAEWKEISNYGRTLSSMKVFPTTVTFDGSENA
PYMEYKFYVDSDSKYTLQTHIAPSNNVDWNNVTMKFAYYIDDDYLNEVDTISPTYIAGTW
RDSTWSNGVRNNIRTVNESLGNLSKGVHTLRVYAVDPAVVLEKFIIYPSSKGLKNSYLGP
EESYYVGK

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	1	577	2.5e-176	0.7245337159253945

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	2.34e-168	42	403	1	333	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	4.97e-54	665	842	1	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam19190	BACON_2	3.48e-07	589	652	24	87	Viral BACON domain. This family represents a distinct class of BACON domains found in crAss-like phages, the most common viral family in the human gut, in which they are found in tail fiber genes. This suggests they may play a role in phage-host interactions.
cd14948	BACON	8.14e-07	596	652	27	81	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam13004	BACON	1.09e-04	596	652	2	59	Putative binding domain, N-terminal. The BACON (Bacteroidetes-Associated Carbohydrate-binding Often N-terminal) domain is an all-beta domain found in diverse architectures, principally in combination with carbohydrate-active enzymes and proteases. These architectures suggest a carbohydrate-binding function which is also supported by the nature of BACON's few conserved amino-acids. The phyletic distribution of BACON and other data tentatively suggest that it may frequently function to bind mucin. Further work with the characterized structure of a member of glycoside hydrolase family 5 enzyme, Structure 3ZMR, has found no evidence for carbohydrate-binding for this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNU66651.1	7.37e-287	1	848	153	986
AQR97306.1	1.45e-283	1	845	119	944
AGF58615.1	5.82e-283	1	845	119	944
AEY65938.1	6.81e-277	1	845	122	947
APC42637.1	2.17e-275	1	848	106	934

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NPS_A	4.14e-201	1	848	124	968	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
4ZMH_A	6.01e-156	1	848	127	938	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
7PUG_A	2.05e-126	1	550	127	655	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	1.21e-123	1	550	126	654	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4C90_A	3.94e-112	1	547	154	667	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003936_00416.