CAZyme Information: MGYG000003934_01471

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; Borkfalkiaceae; Borkfalkia
• CAZyme ID: MGYG000003934_01471
• CAZy Family: GH94
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
841	MGYG000003934_21|CGC1	94355.76	5.2772

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003934	2233390	MAG	United Kingdom	Europe

• Gene Location: Start: 34248; End: 36773 Strand: +

Full Sequence      

MGMKEKAVLLFEKTGRLRRGEAPAGSKLPENTWFLDDSAIACFPRKRGDSRYFYGTDGFY
LWAYQSGYISVNESTFTVFPYADEGKQPYLAFFGGIKDEKGGYLPVSLTGVAAQPRERAE
RCTVFTPTAAYYLTEAEGLRFAVRIYADEKKRVRATLSAQNLTGTDKEIYLSSYLNCLLR
YMPVEDIESKWYKRCGVRENGFLIESVVDLSREEHVNFYAVVRRRTKGDVSGLSATSARA
DFCGGKTVSLNCAEPLFTGSFAEEKKTCGFSDTAVAGEIIRFRLPANGYCEEDLSFEIYR
DPSEAERSLSLPIGESEFDDYVAVAEKKDEEKFVSDRMLKIAFGPFSDKRIDADVLNRFI
GSVIRQVESCALAKTSSLSMLGVRDVFQQIEAALIWNPADCRRKILEALDFIGTDGRAPR
QYSLPARRGSVPVLDLREFIDQGVWIVDALYTYLAYTGDDSVLREECGYYVYRGREASLT
DERDSVLDHLVRIVGYLLANIDDKTHCLRILYGDWNDALDGLGTTEDKDKQFGSGVSVMA
TLQLCRNLEEMSEILRVRSLRPDLVSLYEKKYGEIKEGLQRYAVHKNQSGERRIVHGWGD
KMEYFVGSFQDVDGKSRDGLTANAFWVLSGAYEWDKSIRKEILASYDRLDSKYGLKTFEP
PFARGTRGVGRIPNLPAGTAENGASYAHATLFGIWSQFKMGEGERAWEQLVKVLPPAHEF
ISTSPFVMSNSYIYNEELGVDGESMNDWYTGSAAVLIKALTRCVFGVEVTQTRLKISPSA
YFPCDQAEMSFMVRGVPVRVKYRKGSGVRSVIVNGKRTDGPDGYETALADLKGPLEVEVE
G

Enzyme Prediction     

No EC number prediction in MGYG000003934_01471.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	379	820	3.7e-80	0.40733590733590735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	4.41e-40	381	841	612	1054	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	1.48e-31	381	768	51	425	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH28723.1	6.70e-213	26	820	28	841
BCK01764.1	4.97e-208	1	816	1	843
AVM43012.1	7.82e-201	10	820	17	845
AVM43009.1	1.03e-199	5	795	6	812
ABX81671.1	4.36e-191	1	839	1	827

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QDE_A	2.04e-20	381	820	357	792	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
4ZLE_A	1.49e-17	441	811	405	755	Cellobionicacid phosphorylase - ligand free structure [Saccharophagus degradans 2-40],4ZLF_A Cellobionic acid phosphorylase - cellobionic acid complex [Saccharophagus degradans 2-40],4ZLG_A Cellobionic acid phosphorylase - gluconic acid complex [Saccharophagus degradans 2-40],4ZLI_A Cellobionic acid phosphorylase - 3-O-beta-D-glucopyranosyl-alpha-D-glucopyranuronic acid complex [Saccharophagus degradans 2-40]
5NZ7_A	5.59e-06	439	819	578	989	ChainA, Cellodextrin phosphorylase [Acetivibrio thermocellus],5NZ7_B Chain B, Cellodextrin phosphorylase [Acetivibrio thermocellus],5NZ8_A Chain A, Cellodextrin phosphorylase [Acetivibrio thermocellus],5NZ8_B Chain B, Cellodextrin phosphorylase [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B9K7M6	2.80e-23	381	820	358	794	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
P20471	1.12e-19	382	828	2392	2831	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
Q7S0S2	4.54e-14	441	817	412	768	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1
Q8P3J4	2.37e-13	398	822	376	778	Cellobionic acid phosphorylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=XCC4077 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000013	0.000031	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003934_01471.