CAZyme Information: MGYG000003931_00311

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-552; UMGS1880
• CAZyme ID: MGYG000003931_00311
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1217	MGYG000003931_2|CGC1	133447.28	4.2555

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003931	1842922	MAG	United Kingdom	Europe

• Gene Location: Start: 38158; End: 41811 Strand: -

Full Sequence      

MNKIVKLVINLVCIAIIIVAVSIGTSILYSYESVVDSLLVQNIEDDETFEVASQSGQEMS
RRIMTEGAVMLKNNGALPLDYTDPKNKQVNVFGWRSVDWIYGSEGMNASGGVAPENDDFD
ENVDLYKALSKYGIRYNTELYNMYYDYVEPDHQSANLKGVKITELINLREPRIDDRAYYT
PDVLQNAIDYSDTAIVVIGRMAGEGMNALQTQEKEGSGVVNDATRHYLEISTEEEALLTY
CGETYENVIVILNVANQFECGFLDTIPGIDACLYVGFTGTRAAQAIPGLLYGDVSPSGRT
VDTFAYDLYTNPANVLTGGLYYTDYGRTYTDYVEGIYVGYKWYETADAEGVWSEENGYPG
GYESVVQFPFGYGLSYNEYSWEVGDITFTDTSAATEDGESGANVAAEGAAFTDKTKITIP
VTVTNNGEYPGRDVVEVYVTPPYYNGEIEKAAVTLAAYGKTNELQPGASETIEIVVDPYD
FASYDCYDKNNNEFKGWELDEGDYVFSLRTDSHTVKNVTYNGGERAGSFTFEVEKDITIP
LDPVTGKEVGNLFTGADAVDTTPLDATEKDGSFDPGIPWFTRTDFMLPSEFRANHVRRAA
TPTAKIGVYTSDRAQKWDSATDNDEFGDPIPTEKPTWGADNGLLLADELGNITALGQQLG
ADYDDPQWEQVLNQVTMTEALNVVNFYYGTKEIDSVGKPALKDYDGPAQIKGFTAAPRGT
GYPTMVVIAATWNPSLAYEFGKAFGEDMDSVGVSGVWGWAIDCHRTAFFGRNHESPSEDA
MLAGTTIANAVKGLNTRGKYNFLKHFALYGYGGDSIWVTEQAFREIYLRPFREAFVEGGA
LGAMTTYQGIGAEHSETTIALLTGVLRREWDFKGAITTDYIGESAYCEGLIRAGGNLGMG
VQIGAMSGVTYNENSSARIQHRLRDAVHQTLYMWLRADYNARQYQLNPDEGDSFVSSTVI
KGWQWWKPFITTVDACIGVLCAMWAALVVFSVVFKKKKKPEELTGGTPSDPFGGEPGGVL
SDTAAAEVVPEFAAAPPAPPAAGAEEAEAEDEAPGDVESAPASAAGGAYAEDYAALPDDK
KEYIAAVLKYALGKEGAVEVAGTHGVTVKANGKQLLTIKIRRGVPVAYYKLDNEAIRGER
KELGIRLEYTKIKLRDESSVGAACRMADIMTEQRAREREEANERRKQARRIKREREKAEQ
ANEAEGSAKEENDERQG

Enzyme Prediction     

No EC number prediction in MGYG000003931_00311.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	692	883	3.7e-39	0.8842592592592593

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.04e-21	719	903	80	276	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	8.65e-21	719	882	85	257	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	8.67e-14	68	340	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PRK15098	PRK15098	1.21e-13	270	521	565	763	beta-glucosidase BglX.
PLN03080	PLN03080	6.25e-12	720	879	112	297	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS39538.1	4.28e-220	1	979	1	1003
QUC03329.1	2.17e-196	55	950	61	941
QOY60704.1	6.91e-180	35	950	47	968
ADK67194.1	5.84e-162	67	937	85	970
QOS38997.1	7.36e-149	1	966	1	958

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	6.28e-47	58	880	38	748	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
3AC0_A	8.13e-24	663	882	4	228	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
2X40_A	1.91e-23	690	918	43	273	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
3ABZ_A	1.26e-22	663	882	4	228	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X42_A	1.74e-22	690	918	43	273	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16084	1.00e-67	52	900	24	789	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
P15885	1.44e-56	58	880	11	697	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
Q5BFG8	1.53e-26	664	890	7	241	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
Q9P6J6	1.10e-23	669	882	7	228	Putative beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1683.04 PE=3 SV=1
B0Y3M6	3.34e-23	669	899	7	244	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.663421	0.272506	0.026208	0.001699	0.001017	0.035150

TMHMM  Annotations     

start	end
7	29