CAZyme Information: MGYG000003930_00951

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; CAG-306
• CAZyme ID: MGYG000003930_00951
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
202		22339.18	9.9731

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003930	1618032	MAG	United Kingdom	Europe

• Gene Location: Start: 32981; End: 33589 Strand: +

Full Sequence      

MIRKLLTLTLLFILCILLNPNQVQAETSKATVKDYIVKHSLEMGIDPALGLSIAKMESGF
VHEKRSSFGAVGVFQLMPSTARKLGYNPYYLSDNIRGGLMYYKMMYQKFGSIELALAAYN
AGPGNVSKYKGVPPFAETKRFVKGIMNEYYAQKANPDPAIMKYQGKGSVATVNKALTIDK
ENNVLKGNYFENMPIVTLSGAI

Enzyme Prediction     

No EC number prediction in MGYG000003930_00951.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	42	154	7.1e-24	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.04e-32	33	149	5	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	2.36e-30	47	149	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.02e-29	33	151	7	147	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13403	MLTF-like	6.90e-22	36	126	1	99	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	5.88e-19	44	139	9	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39353.1	6.19e-63	3	176	2	173
AHF97119.1	3.23e-31	19	197	45	209
QJT08226.1	2.12e-30	29	149	79	200
AZT90545.1	3.34e-30	19	146	82	210
AIF43250.1	4.67e-30	20	149	69	206

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	6.57e-13	33	151	417	556	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	6.59e-13	33	151	421	560	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	6.61e-13	33	151	427	566	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	6.62e-13	33	151	431	570	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	6.64e-13	33	151	437	576	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	2.31e-28	24	151	52	181	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	2.94e-27	35	172	1425	1564	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	2.94e-27	35	172	1425	1564	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P39434	5.35e-09	34	161	482	636	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P27380	1.64e-07	40	170	15	140	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000213	0.999066	0.000219	0.000161	0.000156	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003930_00951.