CAZyme Information: MGYG000003927_01751

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminiclostridium_E
• CAZyme ID: MGYG000003927_01751
• CAZy Family: GH26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		43120.97	5.6143

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003927	2497009	MAG	China	Asia

• Gene Location: Start: 432; End: 1520 Strand: +

Full Sequence      

MAYTTDLNAELVSKQASKNTKMLFEYLKSIYGKKHLAGQQYLQNEEVEDLVYYHLTGKLP
AVRGYDFMGVSSCKKTDDQVDRAIKWATECGGIVTMCWHWYAPNDMNDYSKGSSFYYKTT
DYDHKTCFDLCKGVTEGTAEYEFIIREIDMVSAELKRMADLDIPVLWRPLHEANGNWFWW
GNHDDRHREAYKKLWYMIFDRMENYHKLTNLIWVWNGQDKCMEVSPDTFDICGDDIYSVK
EYDHSSQKQRFEYMTELAHGKMITLSECGYIPDPDEMKKDNAMWLWWLPWWGEFVYKREG
YKPVFDKDGYTVINEKYMTEDFMKRVMAHPDVIMREDLPWYDKDKHKLPNALSANLERIK
SK

Enzyme Prediction     

EC	3.2.1.78	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	12	336	6.1e-90	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.50e-42	12	292	1	284	Glycosyl hydrolase family 26.
COG4124	ManB2	2.72e-12	150	307	163	340	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK96404.1	1.50e-283	1	362	1	362
CBL34792.1	1.01e-281	1	362	1	362
CBK96003.1	7.55e-95	12	354	92	437
CBL34396.1	1.51e-94	12	354	92	437
AIQ56350.1	9.30e-76	10	339	14	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	1.20e-52	12	338	7	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	3.99e-50	6	295	140	421	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HF2_A	4.30e-43	7	339	41	357	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
3WDQ_A	1.87e-40	6	339	29	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	4.54e-39	12	321	24	332	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55296	9.94e-52	4	344	150	466	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1
P55297	1.12e-51	4	347	151	470	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
G2Q4H7	3.24e-51	7	311	170	466	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P55298	1.09e-50	7	347	152	468	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
Q5AWB7	2.00e-46	12	295	29	324	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000102	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003927_01751.