CAZyme Information: MGYG000003926_00865

Basic Information

• Species: Rikenella microfusus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Rikenella; Rikenella microfusus
• CAZyme ID: MGYG000003926_00865
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
959	MGYG000003926_79|CGC1	106538.7	6.4355

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003926	2402156	MAG	China	Asia

• Gene Location: Start: 1780; End: 4659 Strand: -

Full Sequence      

MKRLVCLIAAAAAALTAFSQNGHLPRLSPRPRTVEGVAAPVMTLNGTWTFRTETLPSAPI
EVPGEWTMQGFEVGEGETAVYTRTFQLPDDWQGKRIKLRFDGVSSHAAVRINDRLVGEHE
GSMAPFEFDITDAVEPGTNTLTVETQALTVGDRLSCLSQYAAHTVGGILRKATLFALPQT
NIAATDLNTAIDRSGRHAVLEITTALENAPGQEATVEYRLKDAAGKTVAATRQKITGSHP
ATTRLTVRNAEFWNPESPYLYTLSTELRIDGGSVQTNEQRVGLRQVEVRGNRLLVNGRPV
KLHGVNRHEVHPLRGRSLTPELCRRDAEIFKAGNCNYVRTSHYPPSEEFLDACDELGLFV
ESEAALCWMSHGSAPVWGKWDYRDERFLPYMLRANVDNILAGRRHPSVILWSLGNESYWS
PLWQQVLDSVKKIDASRPYSFHDQCWGGYNNGGNRADLWNYHYPSIGSVAACDTMSRPVL
FGEYAHLSCYNRTELVADPGIRAAFGTPLVQLYDTMYRHPGCLGGALWSGIDDTFHLPDG
QIVGYGPWGPIDGWRREKPEYTAMKRAYSPFRIVEQKRTPDGIELTVENRYDFTGFDRVT
IEASEPGDALRRISSRIPARGEGRIFIPAGEKQDIYLRVTGPQGYVCAEELFKAESEAAP
ASRPIEWTAEEAPDALTVRGTAGDGRRYTVVFSKITGLMTKAACDSTSLLLQGPAFSLVA
MDADNGGKPNVANETYQNNLYPKKSYPYLTLFATAFRHERDAAGSVRVETELSYQDGDKG
KIAYRFLPDGRIETTYEITSAKAADPRQYGLVMQLPRAMENLSWRRDAEFSVYPDDDIAR
PEGTARLNARKQYEAEAWREVPQGAWKDDANAMGSVDFRSTRTNILSAALADASGHGIVL
HGDGRQALRCWLQDGRVQMLVADYNNGGSERFYSAPFTDGRIRIEKGDTLTGKLTFELR

Enzyme Prediction     

No EC number prediction in MGYG000003926_00865.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	40	835	1.2e-130	0.9521276595744681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10340	ebgA	2.83e-83	42	824	42	868	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.18e-75	31	650	2	639	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	3.07e-58	44	438	55	484	beta-galactosidase.
PRK10150	PRK10150	2.22e-57	44	441	15	447	beta-D-glucuronidase; Provisional
pfam02836	Glyco_hydro_2_C	2.45e-39	286	546	1	262	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SDS53309.1	0.0	24	959	33	973
QNK61536.1	0.0	16	959	19	968
ARS42988.1	0.0	14	959	16	962
QIL42317.1	0.0	2	959	14	975
QNN40416.1	0.0	14	959	26	972

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DEC_A	6.96e-60	43	903	46	927	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	6.31e-57	43	898	50	926	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6S6Z_A	2.80e-54	42	728	39	762	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	2.81e-54	42	728	40	763	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
1JZ7_A	2.29e-44	43	596	53	629	E.COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_B E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_C E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_D E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],4TTG_A Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_B Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_C Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_D Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	1.54e-53	42	728	40	763	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
Q9K9C6	2.10e-52	43	898	47	936	Beta-galactosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=lacZ PE=3 SV=1
A8AKB8	1.22e-50	43	835	54	912	Beta-galactosidase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=lacZ PE=3 SV=1
P06864	1.24e-50	59	725	98	770	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
Q2XQU3	1.61e-49	21	539	30	581	Beta-galactosidase 2 OS=Enterobacter cloacae OX=550 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.011282	0.709649	0.278271	0.000296	0.000249	0.000231

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003926_00865.