CAZyme Information: MGYG000003912_02011

Basic Information

• Species: Prevotella sp000435635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000435635
• CAZyme ID: MGYG000003912_02011
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328	MGYG000003912_24|CGC1	37236.27	6.3838

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003912	2374877	MAG	China	Asia

• Gene Location: Start: 17440; End: 18426 Strand: +

Full Sequence      

MRKLLSLAMLLMAFTLARAANEYDNPDTLFVAADGSAEFRSVNEALEVCRAFMDYHKVIF
VKKGVYKEKVIVPSWLTNIEICGEDRDETLITYCDHANIVYPPTGKGMGTFRTYTLKVEG
SDITIKNITIENNAPRLGQAVALHTEGDKLVFINCRFLGNQDTIYTGVANTRLYFDGCYI
EGTTDFIFGPSTAWFENCHIHSKANSYVTAASTPEDVPYGYIFYHCRLTAEDGIDKVYLG
RPWRPYAYTLFMECELGKQIVPAGWHNWNNAANERTARYLEYNNTGEGASLGGRVTWSRQ
LTKKESRAVTVYKVFRQDTSWIPDEKLM

Enzyme Prediction     

No EC number prediction in MGYG000003912_02011.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	315	2.9e-99	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02773	PLN02773	4.50e-78	29	305	7	286	pectinesterase
pfam01095	Pectinesterase	3.10e-74	31	318	4	298	Pectinesterase.
PLN02682	PLN02682	2.33e-69	15	307	57	353	pectinesterase family protein
COG4677	PemB	1.04e-61	31	305	87	392	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02432	PLN02432	1.28e-61	31	322	15	292	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84477.1	1.87e-175	19	323	19	323
QVJ81978.1	3.06e-164	1	323	1	322
ADE82952.1	3.06e-164	1	323	1	322
AGB28242.1	4.50e-164	1	325	1	325
QQY41711.1	4.18e-160	1	323	1	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	3.82e-45	31	297	11	281	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	3.59e-40	31	297	7	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.11e-35	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	5.95e-35	29	294	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	9.44e-25	58	323	36	342	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.01e-59	31	322	9	305	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8VYZ3	2.76e-52	38	322	95	381	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
P41510	1.02e-49	28	299	272	550	Probable pectinesterase/pectinesterase inhibitor OS=Brassica napus OX=3708 GN=BP19 PE=2 SV=1
Q43043	1.08e-48	31	322	61	360	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
Q42608	4.39e-48	28	299	259	537	Pectinesterase/pectinesterase inhibitor (Fragment) OS=Brassica campestris OX=3711 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000231	0.999129	0.000184	0.000149	0.000142	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003912_02011.