CAZyme Information: MGYG000003912_01567

Basic Information

• Species: Prevotella sp000435635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000435635
• CAZyme ID: MGYG000003912_01567
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		38092.65	6.6645

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003912	2374877	MAG	China	Asia

• Gene Location: Start: 32726; End: 33733 Strand: -

Full Sequence      

MAFAQQPPTRLWYDKPATCFEESLPIGNGKLGALVYGNPNDDAIHLYDLTFWTGMPVDSA
MDANAHEWIPKTRKALFAENYPLADSLQKHVQEPDSQFHQPLGTLRVRDLSQAPCENYHR
ELDLDSSLVKINYQKDGIRYTREYFASYPDKLIALRIKANKPGGINCEISLTAQVPHSVK
ASQAQLTLTGHAVGDPKESIHYCGIVRTFYEGGHMSVSGSTLTLRGANTLTLYFVNETSF
NGYDKHPVKEGARYLEKAMDEAWHVQNDSYENFRERHIADYRRHYDRLRLHLEGTGENTD
LPTDKRLKEYTDKNANDTYLETQIAGLKPSVNKIH

Enzyme Prediction     

No EC number prediction in MGYG000003912_01567.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	6	323	1.1e-78	0.4224376731301939

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	1.86e-72	11	242	1	233	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB27487.1	8.01e-122	2	321	20	339
BCS85476.1	2.67e-116	4	322	19	337
QNT67409.1	4.34e-116	8	321	29	342
QVJ79894.1	1.71e-115	5	321	19	338
QUB40537.1	2.80e-113	4	315	19	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RDY_A	2.91e-43	10	310	4	321	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
4UFC_A	3.18e-35	10	310	23	320	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
7KMQ_A	1.64e-28	10	314	42	345	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2EAB_A	6.17e-21	21	310	49	358	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	6.17e-21	21	310	49	358	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	1.27e-32	8	298	51	365	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	6.15e-14	11	321	23	346	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q2USL3	3.48e-07	11	321	18	343	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003912_01567.