CAZyme Information: MGYG000003912_00913

Basic Information

• Species: Prevotella sp000435635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp000435635
• CAZyme ID: MGYG000003912_00913
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540	MGYG000003912_5|CGC3	62682.13	8.8465

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003912	2374877	MAG	China	Asia

• Gene Location: Start: 89824; End: 91446 Strand: -

Full Sequence      

MKFRDFMLLAILCTTTFFIYNTALPADIMEVRNIITAREIIDNDSWLYPTLNGVLQLEKP
PLPTWVAAAIEYISPDSLGAQRMAAGVMAVVWITFFYYVALYLSQRKDYALYSTIIFMTC
YNVVQMGRTASWDIYCNAFMMAAIYFLMRGLYDDYFKERQRPWLYLPLAGLMMGLSFLSK
GPVAFYAQLLPALIAALIFIRPLDVREKWKPLAAMVVICLVVSGWWYVYLLLNHHEEVMA
FLSQHAYWGTRIVRPWYYYWRFFCETGVWTTLMLTALMIPFWNKRLPERRGYLIAVTWTL
VALVLLSLIPEKRVRYLLPMMAPCSLAMGYVIIYFKDYCHKDRQAERLFLLNGVVMSVVT
FTLPVLVFIFGYQRDSMHLDSYVGITLLIVLAGLWIARATMNRDARQLIFGVAALFAVIC
SFLLRPIANVFDNPDKNSIHQISKLDLPFYHKADEDLRIELIYSARHQIKPLDLSDEKAV
EKAMPCVVITRDDITKSLSGEQLKKIRLEPLGRFDDNKHPKGNEHYTADFINHATILRQR

Enzyme Prediction     

No EC number prediction in MGYG000003912_00913.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	4	444	1.7e-58	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	8.38e-28	1	415	4	418	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	1.63e-14	59	227	2	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	4.79e-11	37	371	40	367	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	2.37e-06	97	229	101	235	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG5617	COG5617	8.06e-04	60	282	71	289	Uncharacterized membrane protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAI80457.1	6.76e-15	30	462	32	439
AEI13959.1	2.03e-13	30	199	34	197
ATW34349.1	6.48e-13	30	373	34	369
BAT72501.1	1.35e-12	27	450	34	444
ALG45056.1	1.51e-12	30	424	34	429

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8FRR0	9.16e-13	30	428	34	416	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
B2VBI7	2.03e-11	30	388	32	386	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1
Q2NWA9	1.17e-07	30	424	34	425	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=arnT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.994902	0.004378	0.000555	0.000026	0.000016	0.000153

TMHMM  Annotations     

start	end
7	29
83	102
109	126
130	149
162	179
183	200
212	231
257	279
292	309
313	335
348	370
380	397
409	428