CAZyme Information: MGYG000003908_02272

Basic Information

• Species: Odoribacter sp900541415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900541415
• CAZyme ID: MGYG000003908_02272
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
788	MGYG000003908_18|CGC1	88076.97	5.9447

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003908	3732484	MAG	China	Asia

• Gene Location: Start: 7617; End: 9983 Strand: -

Full Sequence      

MKRVMLVVLLAGLVMELCGQTAEHRKMYRRGWIDLNKNGKKDVYEDPAAPVDKRVEDLLR
QMTLEEKTCQLGTLYGFGAVTRDSLPTPEWKERVWKDGLGNIDEHLNGEWKRSSLDFPYY
RHAEALNRVQAFFVEETRLGIPVDFTNEGIRGLKHEKSTFFPAQIGLGSTWNKGLIREIG
HITGLEAKVLGYTNVYSPILDLARDPRWGRTVETYGEDPYLVGELGRQQVEGIQGNRVVS
TPKHFAVYGVPAGGRDCESRTDPHATPQEVHELHLEPFRVAFQEAGALGTMCSHNDYNGT
PISGSHYLLTTLLRDEWGFKGYVVSDSWSIGKLWKFYHVVGSNEEAVAQELKAGINIRTN
FRAPEEFIQTLRKALQEELVTEAELDRRVREVLYVKFWLGLFDEPYVKQPKQADEVVNCE
AHREVALRAGRESIVLLKNEKGLLPLSKDIKKVAVIGPLADNRSAMLCRYGSHNPEVVTG
LAGIRNYLGEGATVLYAKGCAVRDRNFPKSDVMYFPMTGKEQEEIDEAVEAAKQAEVAIV
FVGDDGRTIGESRSRVNLDFSGRQKELIRAVQATGTPVVLVLFNGRPVTMNWEAEYVPAI
VEAWYPGAYSGQAVAEVLWGDYNPGGKLPVTFPKSVGQIPWAFPFKPNANGKGFARVDGS
LFPFGFGLSYTTFEFSDLKLSAEKIGKGDVLTVSCRVKNTGTRAGDEVVQLYLNDEVSSV
SRYVQELCGFERVSLQPGEEKTVTFRVGERAYGMYDAENHFVVEPGDFTLSVGNSSENLV
LKAPFRVE

Enzyme Prediction     

No EC number prediction in MGYG000003908_02272.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	135	357	6.7e-68	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	776	1	754	beta-glucosidase BglX.
PLN03080	PLN03080	5.16e-90	50	783	48	779	Probable beta-xylosidase; Provisional
COG1472	BglX	2.16e-88	62	502	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	8.82e-78	434	670	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	4.50e-65	63	393	1	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA52398.1	0.0	27	787	28	788
QUT73177.1	0.0	27	787	28	788
QRQ47313.1	0.0	27	788	25	786
QIU93424.1	0.0	25	788	38	801
QUT88115.1	0.0	27	788	25	786

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	4.76e-137	51	779	10	744	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	2.62e-136	51	779	10	744	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	2.06e-134	134	776	65	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
5Z87_A	2.19e-134	38	779	30	777	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5O_A	1.13e-133	134	776	65	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	1.16e-143	52	776	35	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	6.40e-143	52	776	35	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	1.65e-141	138	777	62	711	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	6.40e-123	44	776	29	744	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	1.32e-92	46	780	32	769	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000219	0.999146	0.000143	0.000162	0.000153	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003908_02272.