CAZyme Information: MGYG000003908_00765

Basic Information

• Species: Odoribacter sp900541415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900541415
• CAZyme ID: MGYG000003908_00765
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
526	MGYG000003908_2|CGC3	59620.61	8.343

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003908	3732484	MAG	China	Asia

• Gene Location: Start: 276087; End: 277667 Strand: +

Full Sequence      

MTILWALLLCCGLAATGQVSTKKEIPFLKDENWWGAFVAQGSQMPYLKPTNEFNLETQNL
NNQGVPLFVSDKGRYIWSDEPFRFRIAENAIEIKSGTDNVEVVKAGNTLREAYLAACHKH
FPPTGTLPDSLLFSMPQYNTWIELMYNQNQKDILNYADHILKNGYPAGVLMVDDNWQKYY
GNFEFKSDKFPDAKGMIDQLHAKGFKIMVWVCPFVSPDSPEFRELQAKGYLMKRKGSGEP
ALFGWWNGYSACYDLTNPAAFDHYVAKLKEAQERYGIDGFKFDAGDVMYYAPVAFDSYVK
GAKTVDHSQKWAEIGLHFPFNEYRASWKMGGQPLVQRLGDKNYSWRAVGLLIPDMIAAGL
LGYAYTCPDMIGGGQFSAFLNVKKFDEPLIVRSAQTHALMPMMQFSVAPWRILSPENNKI
CADMARLHAKKGNYILACARQSAQTGEPIVRHMEYMFPGQGFANCKDQFMLGDKYLVAPV
ITPENTRQVKLPKGKWRDDLGKIWSGGKVITIQAGLERLPYFEKIK

Enzyme Prediction     

No EC number prediction in MGYG000003908_00765.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	139	523	4e-79	0.9110070257611241

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06592	GH31_NET37	3.84e-171	134	496	1	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam01055	Glyco_hydro_31	1.19e-54	148	522	40	435	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
COG1501	YicI	8.27e-52	57	524	187	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
PRK10426	PRK10426	2.80e-31	182	522	260	616	alpha-glucosidase; Provisional
cd06593	GH31_xylosidase_YicI	6.74e-31	138	298	11	172	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50281.1	3.02e-254	3	526	8	531
QCQ36424.1	2.52e-250	13	525	17	527
QKH84612.1	1.02e-249	13	525	17	527
QCQ51611.1	1.02e-249	13	525	17	527
QCQ32141.1	1.02e-249	13	525	17	527

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2F2H_A	9.59e-31	63	524	195	664	Structureof the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_B Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_C Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_D Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_E Structure of the YicI thiosugar Michaelis complex [Escherichia coli],2F2H_F Structure of the YicI thiosugar Michaelis complex [Escherichia coli]
1XSI_A	9.68e-31	63	524	195	664	Structureof a Family 31 alpha glycosidase [Escherichia coli],1XSI_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSI_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_A Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_B Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_C Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_D Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_E Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSJ_F Structure of a Family 31 alpha glycosidase [Escherichia coli],1XSK_A Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_B Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_C Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_D Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_E Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli],1XSK_F Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate [Escherichia coli]
1WE5_A	3.28e-27	63	524	195	664	CrystalStructure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_B Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_C Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_D Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_E Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli],1WE5_F Crystal Structure of Alpha-Xylosidase from Escherichia coli [Escherichia coli]
5F7S_A	5.57e-25	135	525	290	729	Cycloalternan-degradingenzyme from Trueperella pyogenes [Trueperella pyogenes],5F7S_B Cycloalternan-degrading enzyme from Trueperella pyogenes [Trueperella pyogenes],5I0E_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with isomaltose [Trueperella pyogenes],5I0F_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with covalent intermediate [Trueperella pyogenes]
5I0G_B	5.54e-24	135	525	290	729	Cycloalternan-degradingenzyme from Trueperella pyogenes in complex with cycloalternan [Trueperella pyogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6NSJ0	1.81e-57	103	522	283	710	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
Q69ZQ1	8.88e-56	103	522	282	712	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
P31434	5.24e-30	63	524	195	664	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
Q5AW25	1.79e-27	34	520	187	687	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1
P96793	1.79e-24	63	504	193	646	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000270	0.999165	0.000146	0.000141	0.000131	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003908_00765.