CAZyme Information: MGYG000003891_01428

Basic Information

• Species: UBA11524 sp000437595
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UBA11524; UBA11524 sp000437595
• CAZyme ID: MGYG000003891_01428
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000003891_57|CGC1	42407.04	5.4683

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003891	3063528	MAG	United States	North America

• Gene Location: Start: 2129; End: 3226 Strand: +

Full Sequence      

MDIQQYFQRFLANYTPYKKYWNYEDGCVLKGCIDLYHATGDVLYRDFVLDYVSAYVAADG
SIPNYEMRQYNIDSINSGKALFFALEETGEERYRKAIEFHMQRLREHPRCQCGNFWHKQL
YPNQIWLDGLYMAQPFYMAYEAKFDGMAHVADITRQFQNVRKYLYNPEKGLNYHAYDEAR
VQFWADKETGCSKNFWLRSTGWYLMALVDCIALCSEQLYEHYRALVDIFRESIRGVLAYR
AEDGLFYQVIDHPEAEGNYTETSGSAMIAYSLLKGVRIGVLDAEKYLPIALDVFEKLAAN
KLRVEEDGVVRLTDICWVAGLGPDKNPQRDGSVAYYLSEPKKSDDSKGVGPFIMAYSEYL
RAKQA

Enzyme Prediction     

No EC number prediction in MGYG000003891_01428.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	15	361	9.9e-108	0.9789156626506024

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.08e-94	4	362	13	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.36e-77	8	363	7	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ62178.1	1.84e-145	3	360	8	363
BCJ93648.1	2.40e-140	3	364	6	366
BCJ96410.1	3.74e-122	3	360	6	362
QJS20092.1	5.86e-122	2	360	4	361
AVQ19788.1	2.67e-120	4	358	9	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	9.93e-91	20	359	22	358	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	7.73e-58	21	358	39	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.28e-57	21	358	29	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4Q88_A	8.92e-09	114	364	137	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4XUV_A	9.33e-09	21	330	47	348	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	4.23e-57	21	358	39	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.19e-43	132	360	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.19e-43	132	360	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003891_01428.