CAZyme Information: MGYG000003891_00593

Basic Information

• Species: UBA11524 sp000437595
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UBA11524; UBA11524 sp000437595
• CAZyme ID: MGYG000003891_00593
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
818		93902.12	5.3628

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003891	3063528	MAG	United States	North America

• Gene Location: Start: 6727; End: 9183 Strand: -

Full Sequence      

MTEQMNLGGAWRMREADSETWHSAHVPGSVYADLMADGTMPDPFWRENELDAFERMKKDY
VYQRAFTVSEAQLAHTHVELVCEGLDTLAHVSLNGREIAFADNMHITWVWNVKEQLHAGE
NTLEIRFDSPILYCAKKAEEAPGWESSDATPGFRHLRKAHCMFGWDWGPRLPDAGIWRPI
FLRTWDTARLENALMLQAHHDGVVDVTIRPEIAGESAWSAEITAPDGEVLPLPETMAAEQ
VITIEHPQLWWPNGLGKQPLYRVTVRLATGDTRVWRIGLRTMTVSREKDEWGEEFCHVVN
GMKVFAMGADYIPEDNILARVTPERTRRLLEDCKAANFNAIRVWGGGYYPDDAFYDICDE
LGLLVWQDLMYACAFYDLTPDFERSIRVETHQNVARLRHHASLALICGNNEMEMFMAGAN
SALINHRTWEFVPTYPHHITDYVKMFEYILPAIVKETAPQTYWWPASPSSGGNFDAPNDE
NRGDNHYWDVWHGEKPFTEYRKFFFRYASEFGFQSFPCLKSVKQFTLPDDRNIFSRVMER
HQRNQAANGKILSYLSQTFRYPNSFDDLLYASQLMQAEAIRYGVEHWRRNRGRCMGAIIW
QLNDIWPVASWASIDYYGRWKALHYAAKRFFAPVMISAEEEGELSQNPKINEYHPAPLEK
SFRLNVCNETLRDVTGEVVWALRTPDGAIVRQNQQTLTIPAMSAKWLDKVDCADASLTGH
YVSFAFVVDDVALSEGTCIFCAPKHFEFVDPRLTVETRGDTLVVTSHAYAKQVWLESEDA
DLLLDDNAFDMNPGTKVVRVVKGTAEKVRVRSVWDLGR

Enzyme Prediction     

No EC number prediction in MGYG000003891_00593.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	705	3.4e-103	0.699468085106383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.27e-98	1	789	9	773	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	3.88e-14	750	815	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	2.13e-11	662	745	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10340	ebgA	1.23e-07	61	384	112	413	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	6.97e-05	196	280	12	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS95659.1	0.0	7	816	6	802
AHF25065.1	0.0	3	816	2	809
QIB55233.1	0.0	1	818	1	810
QMW76907.1	0.0	1	818	1	810
QBE99964.1	0.0	1	818	1	810

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	1.39e-158	5	812	6	843	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	1.42e-158	5	812	6	843	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	1.02e-157	5	812	4	841	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	1.05e-157	5	812	6	843	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	5.13e-154	2	813	6	834	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	1.50e-111	4	803	6	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
A2QYN2	4.18e-111	4	653	6	680	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
Q4WAH4	1.17e-110	3	803	5	830	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
Q5B7W2	1.56e-110	7	803	9	828	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
A1CGA8	1.63e-110	3	678	5	696	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003891_00593.