CAZyme Information: MGYG000003883_01744

Basic Information

• Species: Kosakonia cowanii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kosakonia; Kosakonia cowanii
• CAZyme ID: MGYG000003883_01744
• CAZy Family: GT1
• CAZyme Description: Zeaxanthin glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421		45848.46	10.6923

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003883	4218591	MAG	United States	North America

• Gene Location: Start: 8198; End: 9463 Strand: -

Full Sequence      

MSHYAVISPPLYSHMRALEALAQALIARGHRITFVNQAGAQQLLQDPRIGFCAVGEKSHP
PARLQRTLRLMAHPAGPGIIRLIKDLASTTDMLCHTLPAALTQLGVEGVIVDQMEPAGGL
AAESLGLPFVSVACALPVNRDETIPLPVMPFRYAPGERRKKLYRASTQVYDKVMARQNAV
IARHACRFGLPVRNAMHECLSPLAQISQTLACFDFPRQLPAWFHAVGPLRQPQAIAPVSQ
SHAERPLIFASLGTLQGHRYRLFRTIARACRRMNVRLLIAHCGGLNARQVEKLIARGAEV
TDFADQTAVMRDADVVVTHGGMNTVMDAINSTTPILVIPLAFDQPGVAARVEYHQIGRRV
SRFASSARVEKSLRALLADNRYAARLAAMQQPLQQAGGAPRAAQIVELALTSRQPVMAGA
L

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	13	407	1.8e-38	0.9581151832460733

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03784	GT1_Gtf-like	9.45e-41	3	407	2	402	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	7.10e-35	1	407	1	396	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
TIGR01426	MGT	3.56e-33	7	407	1	387	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
cd03785	GT28_MurG	9.52e-06	288	408	227	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PLN02562	PLN02562	1.04e-05	284	386	317	420	UDP-glycosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAR46680.1	2.50e-296	1	421	1	421
AST69143.1	7.16e-296	1	421	1	421
APZ06156.1	4.14e-295	1	421	1	421
QNQ19983.1	2.24e-283	1	421	1	421
AZI88039.1	1.51e-281	1	421	1	421

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	1.56e-16	3	407	5	382	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	1.61e-16	3	407	5	382	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6J31_A	2.43e-09	299	407	282	391	CrystalStructure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	2.45e-09	299	407	285	394	CrystalStructure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
2IYF_A	3.41e-09	299	413	286	401	Thecrystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYF_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P21686	8.47e-155	1	419	1	424	Zeaxanthin glucosyltransferase OS=Pantoea ananas OX=553 GN=crtX PE=3 SV=1
Q01330	3.30e-127	1	416	1	412	Zeaxanthin glucosyltransferase OS=Pseudescherichia vulneris OX=566 GN=crtX PE=1 SV=1
O34539	8.84e-16	3	407	5	382	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
Q65JC2	4.31e-11	3	407	5	387	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
O05496	1.01e-09	1	395	1	375	Uncharacterized UDP-glucosyltransferase YdhE OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhE PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003883_01744.