CAZyme Information: MGYG000003878_01746

Basic Information

• Species: Prevotella oris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oris
• CAZyme ID: MGYG000003878_01746
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524		60487.56	9.8486

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003878	2959023	MAG	United States	North America

• Gene Location: Start: 8154; End: 9728 Strand: +

Full Sequence      

MEIRTIQKDRKEGASKFNLRHTLFAEKGLPNSNIKEQLRRRSICVVIPTYNNGSTIKAVV
EKTLCYCDDVIVVADGCTDNTMDILHGIVHITIVSYPQNKGKGHALKMGFRKALEAGFSY
AITLDGDGQHYPEDILLFLKANQEFPQSLIIGNRQLEGADRSGGSKFANQFSNFWFYVQT
GRALKDTQTGYRLYPLRKLHGLSLLTSRYEAELELLVFASWHGVKIVSVPVGVYYPPRAE
RVSHFRPGMDFARISMLNTVLCILAVVYGLPLRLGRLFMLFLRTAYSLLFFLFFTLVIFT
PFVWIYTRFGKMTEKKRYRLHLLIYHASRFVMIHHGIPGTKFHYKMPDGLDFNIPRIIIC
NHQSHLDLMCQLVFTPKIVFLTNAWVWNNPFYGSLIRNAEYLPVKEGIEEIMPHLRSLIE
RGYSIAVYPEGTRSKDCRIGRFHQGAFYLAKEFNLEVLPMYLYGPGKILPKTSYHLHKGT
FYIEVDKPLTQTELSAMGDLKKQASTMRRRYIQKYEEIANRLEQ

Enzyme Prediction     

No EC number prediction in MGYG000003878_01746.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	44	175	1.7e-17	0.8117647058823529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04179	DPM_DPG-synthase_like	1.32e-38	45	219	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd07989	LPLAT_AGPAT-like	3.32e-34	355	503	25	178	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like. Lysophospholipid acyltransferase (LPLAT) superfamily member: acyltransferases of de novo and remodeling pathways of glycerophospholipid biosynthesis which catalyze the incorporation of an acyl group from either acylCoAs or acyl-acyl carrier proteins (acylACPs) into acceptors such as glycerol 3-phosphate, dihydroxyacetone phosphate or lyso-phosphatidic acid. Included in this subgroup are such LPLATs as 1-acyl-sn-glycerol-3-phosphate acyltransferase (AGPAT, PlsC), Tafazzin (product of Barth syndrome gene), and similar proteins.
cd04188	DPG_synthase	1.43e-20	45	231	1	202	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
cd06442	DPM1_like	1.60e-18	45	231	1	197	DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily.
TIGR00530	AGP_acyltrn	2.06e-18	351	463	9	130	1-acyl-sn-glycerol-3-phosphate acyltransferases. This model describes the core homologous region of a collection of related proteins, several of which are known to act as 1-acyl-sn-glycerol-3-phosphate acyltransferases (EC 2.3.1.51). Proteins scoring above the trusted cutoff are likely to have the same general activity. However, there is variation among characterized members as to whether the acyl group can be donated by acyl carrier protein or coenzyme A, and in the length and saturation of the donated acyl group. 1-acyl-sn-glycerol-3-phosphate acyltransferase is also called 1-AGP acyltransferase, lysophosphatidic acid acyltransferase, and LPA acyltransferase. [Fatty acid and phospholipid metabolism, Biosynthesis]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH15090.1	0.0	1	524	1	525
QUB84867.1	1.47e-315	31	524	3	496
AUI56689.1	1.65e-314	31	524	2	495
QUB81895.1	2.70e-311	31	524	3	496
QUB75218.1	2.86e-306	31	524	3	496

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3VA58	6.29e-17	43	235	6	220	UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminyltransferase OS=Methanococcus voltae OX=2188 GN=aglK PE=1 SV=1
Q8GXU8	2.05e-15	355	489	195	334	1-acyl-sn-glycerol-3-phosphate acyltransferase LPAT1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LPAT1 PE=1 SV=1
Q9LLY4	3.30e-15	355	499	181	330	1-acyl-sn-glycerol-3-phosphate acyltransferase BAT2, chloroplastic OS=Brassica napus OX=3708 GN=BAT2 PE=1 SV=2
Q42670	1.21e-10	348	489	115	263	1-acyl-sn-glycerol-3-phosphate acyltransferase OS=Cocos nucifera OX=13894 PE=1 SV=1
A8J0J0	1.96e-10	355	489	156	295	1-acyl-sn-glycerol-3-phosphate acyltransferase CHLREDRAFT_174358 OS=Chlamydomonas reinhardtii OX=3055 GN=CHLREDRAFT_174358 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
251	270
285	307