CAZyme Information: MGYG000003878_00321

Basic Information

• Species: Prevotella oris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella oris
• CAZyme ID: MGYG000003878_00321
• CAZy Family: CE3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
694	MGYG000003878_8|CGC1	78332.45	8.7157

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003878	2959023	MAG	United States	North America

• Gene Location: Start: 24429; End: 26513 Strand: +

Full Sequence      

MKLHLRMSFILCCSLLIAVSGMGKNRIKVACVGNSVTFGYGLSNREQTCYPAVLQRMLGA
NYEVKNFGHSGTTLLTQGHRPYIQQTEYKEALAFKPDWVVIHLGLNDTDPRNWPNYNSAF
DADYQQLINSFRKATPKAKLWICLMTPIFHTHPRFESGTRDWHAAIQKYIRRIAKANQVG
LIDLHTPLYSRPDLFADALHPNAEGAEIMAQTIYSATTGDYGGLKMSPLYADEMVMQRQQ
PIVFRGTANAKERVEVNFNGQRLSAVTDTNGQWNVSFPAMDAGGPYEARITTKHGMLTIH
HIYIGEVWLCSGQSNMEYPVKATTTAAEDEQLAAHLPLLHLYNMPTRFPTNAEKWSKAVL
DSVNKLALLGGQTWQRASKETVSKFSSVAYHFGKALADSLKVPVGIICNAVGGTTTESWI
DRHTLEWQFPSILHDWYHGDFGQPWARKRALENIANAENIALQRHPYTPCYMFEAGILPL
KDYAIRGVAWYQGESNAHNIELHARLFRLLEKSWRHFFHQPKMPFLIVQLSSLNRPSWPE
FRNSQRLLAAQQPQTWLTVTSDMGDSLDVHYRNKQPVGKRLALQALHHVYEHAIVSEGPS
CIKARAVGELVYLYFENAQRLQTKEGPLTGFEVAGEDGVYHAAKAEIDGESVIVSCAEVP
HPQTVRYGWHPFSRANLVNEALLPCSTFKKKIPK

Enzyme Prediction     

No EC number prediction in MGYG000003878_00321.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	27	216	6.7e-18	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01827	sialate_O-acetylesterase_like1	2.22e-82	27	218	1	188	sialate O-acetylesterase_like family of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
pfam13472	Lipase_GDSL_2	4.98e-31	31	208	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd00229	SGNH_hydrolase	1.75e-26	29	216	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
cd01834	SGNH_hydrolase_like_2	1.15e-21	27	216	2	191	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
COG2755	TesA	9.09e-17	28	216	10	207	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB42485.1	4.98e-228	27	688	31	692
AHW60353.1	2.59e-215	24	693	33	705
AWI09525.1	5.78e-85	224	689	636	1123
QDT62262.1	9.58e-75	125	689	858	1439
AGA56715.1	1.41e-69	202	689	260	739

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KMM_A	1.10e-48	229	689	28	632	ChainA, Sialic acid-specific 9-O-acetylesterase [Xanthomonas citri pv. citri str. 306],7KMM_B Chain B, Sialic acid-specific 9-O-acetylesterase [Xanthomonas citri pv. citri str. 306]
5JD3_A	3.60e-07	28	217	29	233	Crystalstructure of LAE5, an alpha/beta hydrolase enzyme from the metagenome of Lake Arreo, Spain [uncultured bacterium],5JD3_B Crystal structure of LAE5, an alpha/beta hydrolase enzyme from the metagenome of Lake Arreo, Spain [uncultured bacterium],5JD3_C Crystal structure of LAE5, an alpha/beta hydrolase enzyme from the metagenome of Lake Arreo, Spain [uncultured bacterium],5JD3_D Crystal structure of LAE5, an alpha/beta hydrolase enzyme from the metagenome of Lake Arreo, Spain [uncultured bacterium],5JD3_E Crystal structure of LAE5, an alpha/beta hydrolase enzyme from the metagenome of Lake Arreo, Spain [uncultured bacterium],5JD3_F Crystal structure of LAE5, an alpha/beta hydrolase enzyme from the metagenome of Lake Arreo, Spain [uncultured bacterium],5JD3_G Crystal structure of LAE5, an alpha/beta hydrolase enzyme from the metagenome of Lake Arreo, Spain [uncultured bacterium],5JD3_H Crystal structure of LAE5, an alpha/beta hydrolase enzyme from the metagenome of Lake Arreo, Spain [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D5EV35	2.92e-32	24	216	271	478	Acetylxylan esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axeA1 PE=1 SV=1
P70665	2.97e-28	261	634	70	468	Sialate O-acetylesterase OS=Mus musculus OX=10090 GN=Siae PE=1 SV=3
P82450	3.00e-28	223	625	25	462	Sialate O-acetylesterase OS=Rattus norvegicus OX=10116 GN=Siae PE=1 SV=2
Q5RFU0	1.15e-25	223	634	25	442	Sialate O-acetylesterase OS=Pongo abelii OX=9601 GN=SIAE PE=2 SV=1
Q9HAT2	4.88e-25	223	634	25	442	Sialate O-acetylesterase OS=Homo sapiens OX=9606 GN=SIAE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000436	0.998765	0.000326	0.000153	0.000150	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003878_00321.