CAZyme Information: MGYG000003867_00545

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Catenibacillus
• CAZyme ID: MGYG000003867_00545
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831	MGYG000003867_12|CGC1	96072.97	4.9808

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003867	2363031	MAG	United States	North America

• Gene Location: Start: 11347; End: 13842 Strand: -

Full Sequence      

MKKISLDGVWQMSESGSAHKLAVNIPGSVLSGLLENKKIDDPYDGINEYQTRALLYKDYV
FEREFDMPDGWIFGQQGTKTELVCDGLDTIARIFVNDAEIGFADNMHRTWRFDCGSILKR
HNSIKIEFTSPVTYIENHPMTSGKEIAYKACGCMDGSQYIRKAHSMFGWDWGPQLPDMGI
WRGIRIEQTKTARIEDVDILQFHKENRVDVRLKMSLSVVKSSDLAGLEFSAEILSPDGMR
IDKKVKEFSEQLTSELDFEIHSPKLWWPNGLGEHPLYTILTVLLDCNGQVLDEKIYRIGL
RTISVSRQKDSWGSEFAFVVNGVKIFAMGADYIPEDCIYSRIDKNKMQYLIDTAVCSNFN
CLRVWGGGYYPSDEFYDLCDENGLLVWQDLMYACNVYDISDAFEENIIAETLDNVRRIRH
HACLGLWCGNNEMEMGWVDWQDVSCHSGLLRADYIKQFEYILPKAVKSVDSQTFYWPSSP
SCGGGFVSPNDENHGDTHYWDVWHGQKPFSDYRKYYFRFCSEFGFQSFPLLKTVKTFTRP
EDRNIFSEVMESHQKNGAANGKILYYISENFLYPKDFESLLYVSQILQGLAIKYGVEHWR
RNRGRCMGALYWQLNDNWPVASWSSVDYFGRWKVLQYMAKKFFAGTLGTIYEENGVIYVA
AVNDTMEAVSVQVSVRLKNMMLDVLDEYRVSEDVEALSAKKLGFRSFDGFLENKNELFVE
AVFEFSNGSRAVQTETFVPYKHLKIRRPEISLNIKENEGDYEIHLKTDVYTPFVWLDLEK
NDVRFSDNGFYMTDKNTMIIRADKNDCITGEGLTLKMFEEQLFVRTLYDTI

Enzyme Prediction     

No EC number prediction in MGYG000003867_00545.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	677	4.9e-99	0.6555851063829787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	9.67e-102	1	790	10	773	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	4.28e-16	747	829	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	1.53e-12	192	301	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	6.15e-10	1	436	71	453	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	2.52e-09	655	742	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL20579.1	1.62e-307	1	827	1	838
QCU02115.1	1.31e-305	1	827	1	824
CBL13897.1	1.50e-301	2	830	12	855
VCV23589.1	2.36e-301	2	830	5	848
CBL08662.1	2.36e-301	2	830	5	848

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	3.71e-147	1	831	3	854	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	3.81e-147	1	831	3	854	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	2.71e-146	1	831	1	852	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	2.78e-146	1	831	3	854	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	1.59e-144	6	790	11	804	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4FZV0	6.65e-120	5	800	24	856	Beta-mannosidase OS=Rattus norvegicus OX=10116 GN=Manba PE=2 SV=1
Q95327	1.82e-118	4	830	23	878	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q8K2I4	7.57e-116	5	800	24	854	Beta-mannosidase OS=Mus musculus OX=10090 GN=Manba PE=1 SV=1
Q29444	2.89e-115	4	830	23	878	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
O00462	1.19e-112	5	800	24	854	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003867_00545.