CAZyme Information: MGYG000003856_01452

Basic Information

• Species: Paramuribaculum sp900551515
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp900551515
• CAZyme ID: MGYG000003856_01452
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
815		90354.69	5.478

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003856	2220083	MAG	United States	North America

• Gene Location: Start: 9352; End: 11799 Strand: -

Full Sequence      

MTNSPRLRLSQLFLSISLLSAVPAFASSTASNTIWFDTPNSSTEGVAVWRFNDFSASANP
DPAWENSALPIGNGAFGATVMGSVERERIVLNEKTLWMGGPGTGPETYWDMNRKVSRQQL
DSIRTLLTEHRTAEADRMCARLFSGSTPYDRSRFGTFTMMGEAYVATGIPDSTITGYRRE
LNIDSAIVTVSFNDGPAHYTRRYFASYPDSVMVWQYRSEGATQNLAFSFDSPHAIASVTS
PAPGALLYTGRLEGNGMQWALRVDVRTSGGGTVTADPATGIISVTGSTDAEFILSGDTDY
VMNFNPDPADPKAYTGVDPVATVNNNVTRAAALPYATLLRHHLTDYQNLYNRVDIDLGGA
DRCHLTTPQRLAEYRTGTADPNLEELFFRFGRYLLIASSRPGTMPANLQGLWNNNIDGPW
RVDYHNNINLQMNYWPAMSTNLTECFTPFIDYVSSLIVPGSRTAADYYGARGWTAEVSTN
IFGFTAPLASDDMSWNYNPTAGPWLTTQIWEYYDYTRDDDWLRRVGYPIIKGSADFVSDL
LMLHNGSYTSAPSYSPEHGPCDLGATYANAVTREVLTEAIRAAKILGTDADESRRWQEKL
DSIYPYQIGRFGQLQEWYDDIDTYGDQHRHTNHLFGLHPGSTINPLVDTKLADACRETLR
QRGDAATGWSMGWKLNHWARLLDGDHAHILLENLLKNGTADNLWDLHPPFQIDGNFGATA
GIAELFLQSHTGKLHLLPALPSQWRDGHIKGLLARGNFEVNITYKGNRLDEAVITSRAGG
PCTVLYDGRETTFDTSRGASYRITASKDRLKVSPL

Enzyme Prediction     

EC	3.2.1.63

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	59	791	1.9e-253	0.9764542936288089

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	4.71e-42	62	302	6	233	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
pfam03633	Glyco_hydro_65C	0.002	738	792	1	50	Glycosyl hydrolase family 65, C-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The C-terminal domain forms a two layered jelly roll motif. This domain is situated at the base of the catalytic domain, however its function remains unknown.
COG1554	ATH1	0.008	509	624	443	576	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam08411	Exonuc_X-T_C	0.008	353	390	152	199	Exonuclease C-terminal. This bacterial domain is found at the C-terminus of Exodeoxyribonuclease I/Exonuclease I (pfam00929), which is a single-strand specific DNA nuclease affecting recombination and expression pathways. The exonuclease I protein in E. coli is associated with DNA deoxyribophosphodiesterase (dRPase).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT86772.1	6.14e-303	29	815	25	818
AII61834.1	1.75e-302	29	815	25	818
AND18886.1	1.75e-302	29	815	25	818
AII67145.1	2.48e-302	29	815	25	818
QJR74931.1	2.48e-302	29	815	25	818

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4UFC_A	2.48e-154	58	779	27	736	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
7KMQ_A	1.07e-144	39	789	34	762	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2RDY_A	1.12e-141	60	785	10	753	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
2EAB_A	2.91e-129	34	784	20	849	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	2.20e-128	34	784	20	849	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	2.48e-131	60	788	59	816	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	1.86e-108	30	776	19	764	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q5AU81	6.50e-81	71	761	46	772	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
Q2USL3	6.05e-59	63	788	25	719	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000427	0.998789	0.000210	0.000220	0.000175	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003856_01452.