CAZyme Information: MGYG000003852_00883

Basic Information

• Species: Sutterella sp900762445
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Sutterella; Sutterella sp900762445
• CAZyme ID: MGYG000003852_00883
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	MGYG000003852_9|CGC1	44794.92	5.3646

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003852	1962706	MAG	United States	North America

• Gene Location: Start: 34261; End: 35466 Strand: +

Full Sequence      

MNKTLRLLSLSVLGALTSWNVMAADAPANTEAKAEAQTLVSESLPALHPVRSLKNAPTDT
WPAWKEFRESALDAGRVIDRSDERLITTSEGQSYGMFFALVANDRPSFDAMWQWTVANLC
EGDCGKTRMAWLWGANESVKNAKAPLKWGVIDSNNATDADLWIAYTLLEAADRWEEPKYR
DDAMKLLERVKADVRVVRGLGAVLLPANVGFEKNGDVVLNPSYYPISVLKRLETVDPLWR
EVRWGSMRALVRSAESGLSPDWVAFGERWGSRNRDESSEGSWNAIRVYLWAGMMPQDDPD
AVRLREILSPMVDVAKRRFYTPVSTDTAAFTVSKSGPFAFGACVLPWVKDDKVGAYIRTG
LSKMAFTGEDYYRSVLVLFGLGFDQGRFAFDHQGRLMIQGD

Enzyme Prediction     

No EC number prediction in MGYG000003852_00883.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	61	383	9.3e-73	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	4.68e-117	52	396	16	364	cellulase.
COG3405	BcsZ	8.95e-71	59	390	24	350	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	4.90e-55	58	386	1	321	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA53782.1	4.46e-108	43	397	51	408
QDA53874.1	3.78e-103	52	399	15	361
QQS88762.1	1.78e-101	61	398	28	361
ANU67169.1	1.42e-94	57	401	18	353
QQQ96024.1	1.42e-94	57	401	18	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QXQ_A	8.71e-83	60	397	3	336	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
7F81_A	5.44e-80	60	396	7	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
4Q2B_A	1.44e-79	58	397	1	340	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]
7F82_A	1.53e-79	60	396	7	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]
3QXF_A	7.65e-78	60	397	3	336	Structureof the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_B Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_C Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12],3QXF_D Structure of the bacterial cellulose synthase subunit Z [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X5L9	1.58e-83	60	397	24	357	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
P37651	2.51e-82	60	397	24	357	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
Q8ZLB7	3.61e-79	60	397	25	358	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8Z289	8.02e-78	60	397	25	358	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
P58935	1.73e-63	46	397	17	372	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000307	0.998955	0.000204	0.000181	0.000161	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003852_00883.