CAZyme Information: MGYG000003843_00516

Basic Information

• Species: UMGS693 sp900544555
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-138; UMGS693; UMGS693 sp900544555
• CAZyme ID: MGYG000003843_00516
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361	MGYG000003843_2|CGC1	39098.22	9.8791

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003843	2332331	MAG	United States	North America

• Gene Location: Start: 1104; End: 2189 Strand: +

Full Sequence      

MKKIILMTGGGSAGHVTPNIALMPRLADEGFDIHYVGMAGSIEQKLVQGRPGVTYHTITS
GKFRRYFSWKNFTDPFRVVKGVFQAKRIIRSVKPDVVFSKGGFVSVPVCIAARRKAPVVV
HESDYTPGLANRIGARFADTVCVTFSDTLNQVGAKGVHTGTPIRPELYNGKREKGLEFLG
FKGDRPILLVMGGSLGALAVNEAVRGALKTLTVKYDIVHLCGEGKMEPGLDMAGYAQYEY
IASELPDVFAAVDIVISRAGANAVFELLALKKPAVLIPLPASSSRGDQIHNAGYFARKGY
ALYLKQSELTADTLLDAVEELFNHRLEFVSAMNAEPAADGTEKVLNVIKKAAQNRLGSNN
R

Enzyme Prediction     

No EC number prediction in MGYG000003843_00516.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	188	333	4.4e-40	0.9235668789808917

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12446	PRK12446	3.28e-138	3	351	2	352	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed
PRK00726	murG	4.52e-136	1	354	1	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	4.96e-113	5	347	2	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	1.73e-104	3	352	1	355	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	2.57e-93	2	325	1	322	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBF44674.1	1.06e-132	1	353	1	354
AYH40137.1	2.23e-129	1	348	1	346
BCJ97020.1	2.30e-129	1	350	1	351
AZV55903.1	4.63e-129	1	352	1	353
BCN32922.1	4.63e-129	1	353	1	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7D1I_A	8.54e-40	3	350	10	364	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
3S2U_A	8.77e-39	1	324	1	324	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	5.32e-27	3	353	7	355	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q97GY4	2.06e-127	1	350	1	353	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=murG PE=3 SV=1
Q8XIQ1	3.15e-126	1	352	1	355	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=murG PE=3 SV=1
Q0TNP7	3.15e-126	1	352	1	355	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=murG PE=3 SV=2
Q0SRB4	3.15e-126	1	352	1	355	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=murG PE=3 SV=1
A9KK83	8.38e-126	1	350	1	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003843_00516.