CAZyme Information: MGYG000003841_00658

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae
• CAZyme ID: MGYG000003841_00658
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1214	MGYG000003841_72|CGC1	129463.97	4.5527

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003841	1511057	MAG	United States	North America

• Gene Location: Start: 2397; End: 6041 Strand: -

Full Sequence      

MATIKNQGTSATPAGTVCGVRFSVGGLNTMPFTWNDQYTAAIPAGGEVQLSATGGSNGNT
WTAAAAGTYTVYAWVDDANRINESNKNNNQFTTTVTVSNSTPTTEPTTETPTEPVTEPEQ
KDATDLYLVSLSTTRQTIYKGQEVYGQLMIKNTSDAAKPAGKALSINVYVDGTLNHTISY
TGEIAAHGTAMVTTNKWIATLGSHSVRATINADGNIPEDDNTYANKRYSKYIVVENPNPT
EPSTEPSTEPSTEPPTTPPDPSGTISQKYEAENGTRTGGAGIATEHAGYSGTGFVDRIQA
VGDGVTFTNVNVPSSGYYTLITGYAAGPNGFDGNDIRTMSVAANNGEFQQFSFPKTSTSA
WNVYGTARGLIYLQAGSNTISYRYQSGDNGNLNLDYMIVEGPVEAVDLTITSLAMKNNTT
PGSGAAKDESISFVATVKNQGTGRVAAGTTINVSFVIDGTTIQGSTRLSSALAPNGTVQI
TSATWKAVEGSMSVTATVDPGNTITEVNKNNNSSTLDFTVSPMRGKDLVISKVYFEGDVQ
VGNTITVCAEVSNIGTEAVTEGFYTKAVVDGATEIVSPLYTGALAPDAKATIVIGRYVVP
AGGAKMVVTVDSTNRVAETNESNNTMSTTVEKWDMDAAWVTYQAEDGTTGGGATVERGTP
TKDGTIGTIGGEAVGRAAVKLASTGSYVQWTASEAANSIVLRATIPDVGDNGNGTISVYV
NGVKKTTLDVTSKYSWFYVDESYTDEQGYNSALNNPSTTDNGGSPRHIYDECHKLLDFTI
NAGDVVKLQKDAGDTCEYYGIDFIELEKVDGPKPCPENFLDITKYEGYNGNITTGIYGFI
QNWGNNKNKPEYQGLKGLYIPAGRYEMTSQIQMYNVDVGFQIVGAGMWHTVLYTNNGGDS
DWGAAGFNMNGHGTVFKDFAFFGASSSRTGSGKPFFNGYGDGTRFENIWIERFTCGEWVG
GGSGITTNLATVNCRFRNTGADGINYCNGTKNSVVENTHIRSTGDDGIAIWSAPEMDGPS
ADISYPGCARNTVRNCRIEAPWRANCLAIYGGMDNTMTKITARDSLTYAGIMVSSEFEPR
PFTGTTTVEKINFERCGGWMWGRRPFGAIWVRCYNNAKNPVKGINFKDINITDAWTNGIV
ITMERNNSIEEVVFENVNVNGFNGSYGILIEKDTQPLGDGSGVTFRNCQVAGTGTKFMNQ
IGSSFAVTKSGCNF

Enzyme Prediction     

No EC number prediction in MGYG000003841_00658.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	637	1201	7.1e-137	0.8375209380234506
CBM35	269	398	3.1e-27	0.9831932773109243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14490	CBM6-CBM35-CBM36_like_1	1.46e-50	639	806	6	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
cd04083	CBM35_Lmo2446-like	5.11e-35	268	399	2	125	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
cd04082	CBM35_pectate_lyase-like	1.47e-19	269	399	3	124	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
cd04086	CBM35_mannanase-like	9.82e-19	268	400	2	119	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.
pfam07705	CARDB	1.55e-14	407	515	3	100	CARDB. Cell adhesion related domain found in bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATB40306.1	7.53e-174	262	1213	240	1149
ATB34352.1	1.29e-171	262	1213	246	1153
QRN97708.1	7.16e-171	264	1213	261	1168
ADO68245.1	6.27e-167	261	1214	260	1171
QRK13764.1	2.16e-163	264	1155	241	1093

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZRU_A	4.51e-58	642	1176	21	536	ChainA, Alpha-1,3-glucanase [Niallia circulans],5ZRU_C Chain C, Alpha-1,3-glucanase [Niallia circulans]
6K0M_A	3.74e-56	671	1149	47	503	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
6K0S_A	4.15e-55	671	1149	47	503	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]
6K0P_A	4.15e-55	671	1149	47	503	Catalyticdomain of GH87 alpha-1,3-glucanase D1045A in complex with nigerose [Paenibacillus glycanilyticus]
6K0Q_A	1.74e-48	671	1149	47	503	Catalyticdomain of GH87 alpha-1,3-glucanase D1068A in complex with nigerose [Paenibacillus glycanilyticus],6K0U_A Catalytic domain of GH87 alpha-1,3-glucanase D1068A in complex with tetrasaccharides [Paenibacillus glycanilyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70873	9.20e-10	265	395	411	533	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 GN=cit PE=3 SV=1
P94286	9.23e-10	260	395	417	541	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 PE=1 SV=1
Q56F26	4.24e-06	269	395	911	1028	Exo-beta-D-glucosaminidase OS=Amycolatopsis orientalis OX=31958 GN=csxA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999961	0.000088	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003841_00658.