CAZyme Information: MGYG000003837_00190

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas
• CAZyme ID: MGYG000003837_00190
• CAZy Family: GH77
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604		70400.49	5.9235

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003837	2173953	MAG	United States	North America

• Gene Location: Start: 96282; End: 98096 Strand: -

Full Sequence      

MSQMPRQAGIAVPLFSLRRHGDAGCGDFAALEAFAPVAERMGMSIIQLLPLEDTTLYGDS
RDSYPYRPLASTVLNPIYIAVDQLPPLADQQLEQELRAEAERLSAQKAFDYTAVWQLKRR
WLWASFTEQVDASPYFTDMINRYAGLTLRNAPFKSTPIWHYWVCMRMALDLLPDLNREEW
DFWDAMKRVKELEQENKRLVVCTGNFYAYCYMVAQRQMRRAVATIRQHGLALMGDLPVGV
DPHAADTIAYPRKFNKRLSCGAPPDYFSPDGQNWGILTCRRNWRMLWQERFDYLERFYDY
LRVDHVLGFFRMWSIPRDGRSGMLGYFLPSRRYLKREIAKLGLAETLRPEWIAPTKNPAT
TQVLWIERLDAGYVPRYDVASTAPFAKLSPDLQERMRAVCEEYYYGGNEELWRERGLERL
TFLKSLTSIHLCAEDLGMVPQCVYPVLEELGILKLYVERMPKSAGIEFEAAPYFSEDSVG
TTSTHDCAPLRLWWAEDEARSRRYYDYFLTDYGVPYDTTLTPELAEIIVRRHLESPSRLC
ILPLQDWLALSSEHCAMVDPHSEQINDPSNPHHVWCYRMPSHVEELPDDWIRQLRQMITE
THRL

Enzyme Prediction     

No EC number prediction in MGYG000003837_00190.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	12	596	5.4e-102	0.9838056680161943

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02950	PLN02950	2.40e-110	6	589	260	902	4-alpha-glucanotransferase
PLN03236	PLN03236	5.76e-107	6	604	60	742	4-alpha-glucanotransferase; Provisional
pfam02446	Glyco_hydro_77	8.73e-101	12	580	1	458	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.
COG1640	MalQ	3.02e-68	3	603	9	518	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK14508	PRK14508	4.31e-48	2	604	1	497	4-alpha-glucanotransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE12916.1	0.0	1	604	1	604
QUB42334.1	1.01e-107	3	604	232	883
AAQ65928.1	4.24e-106	4	603	1	653
ATS03430.1	1.47e-104	4	598	240	887
ALO29872.1	2.06e-104	4	603	240	892

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5CPQ_A	5.05e-18	6	594	70	557	Disproportionatingenzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPQ_B Disproportionating enzyme 1 from Arabidopsis - apo form [Arabidopsis thaliana],5CPS_A Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPS_B Disproportionating enzyme 1 from Arabidopsis - maltotriose soak [Arabidopsis thaliana],5CPT_A Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CPT_B Disproportionating enzyme 1 from Arabidopsis - beta cyclodextrin soak [Arabidopsis thaliana],5CQ1_A Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CQ1_B Disproportionating enzyme 1 from Arabidopsis - cycloamylose soak [Arabidopsis thaliana],5CSU_A Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSU_B Disproportionating enzyme 1 from Arabidopsis - acarviostatin soak [Arabidopsis thaliana],5CSY_A Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana],5CSY_B Disproportionating enzyme 1 from Arabidopsis - acarbose soak [Arabidopsis thaliana]
2X1I_A	3.77e-16	34	585	32	484	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]
1X1N_A	3.90e-15	6	604	26	524	Structuredetermination and refinement at 1.8 A resolution of Disproportionating Enzyme from Potato [Solanum tuberosum],6LX1_A Potato D-enzyme complexed with Acarbose [Solanum tuberosum],6LX2_A Potato D-enzyme complexed with CA26 [Solanum tuberosum]
7COV_A	4.43e-15	6	604	78	576	PotatoD-enzyme, native (substrate free) [Solanum tuberosum]
4S3P_A	1.63e-14	9	316	145	460	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q69Q02	2.03e-90	6	603	263	921	4-alpha-glucanotransferase DPE2 OS=Oryza sativa subsp. japonica OX=39947 GN=DPE2 PE=2 SV=1
Q8RXD9	1.56e-82	6	589	269	911	4-alpha-glucanotransferase DPE2 OS=Arabidopsis thaliana OX=3702 GN=DPE2 PE=1 SV=1
Q9PKU9	8.74e-37	9	586	30	513	4-alpha-glucanotransferase OS=Chlamydia muridarum (strain MoPn / Nigg) OX=243161 GN=malQ PE=3 SV=1
Q9Z8L2	2.96e-36	9	586	26	509	4-alpha-glucanotransferase OS=Chlamydia pneumoniae OX=83558 GN=malQ PE=3 SV=1
O84089	5.67e-31	9	586	30	513	4-alpha-glucanotransferase OS=Chlamydia trachomatis (strain D/UW-3/Cx) OX=272561 GN=malQ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999237	0.000784	0.000004	0.000002	0.000001	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003837_00190.