CAZyme Information: MGYG000003835_02504

Basic Information

• Species: UBA7173 sp001915385
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp001915385
• CAZyme ID: MGYG000003835_02504
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
668	MGYG000003835_30|CGC1	74466.4	6.114

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003835	3225656	MAG	United States	North America

• Gene Location: Start: 7164; End: 9170 Strand: +

Full Sequence      

MQKLLLSCLILTTPLSVLASNKTYSHDGRQLTVDNSTGAVTIVAGNDTIIKANIPAWGLD
DNVRRPDALQKVKSSSRRISDVHGDALRVSVTGTYGNEKATVDYDIYPQFILTRLSVEGD
AAQKDGFALNFLAPVSTRQSYQFADRAGNYAVSVPYDNDAWVRYTNTPFGDAIPESYEVA
ALFNADTRKGLVIGSVEHDIWKTGIKTATDANAAIVSLEAFGGASSELTRDKRPHGHVAG
KSVKSPRIILIPADDWRDGLELFADQCAAFAPSVPSKGPRPFGWNSWGKLQTKITYDKAI
EVSDFIHDNITNRGFHDADSSVVIDLDAFWDFGFKPHQHRQFVEHCRANGQKAGIYWCPF
TDWGGNPDGVLGEDPQYKMKDLYIYVNGEPVKFDGAPALDPTHPGTKARIKRQLEQFIDW
GYEYVKIDFMAHGAYEGDTHYDPSVTTGTQAFNQGMAYIDSINNNRLWINLSIAPLFPAN
YAHSRRISCDAWAGVKDTEYVLNALTYGWWLDHLYHYNDADHVVYEGATDGENRMRITSS
ALTGVYFLGDDMSKDGLESTKERIIRNTGNREINAMARNCKSFRPVEHAKGTSAADMFTN
SDDKYIYVAIFNFTDRPVEKTLPLRRLGLSESINYLAMELWSHDTLNVNGAINVAIPARD
VKVFRIEK

Enzyme Prediction     

No EC number prediction in MGYG000003835_02504.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.12e-14	279	564	1	294	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	4.05e-11	281	521	2	214	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam17801	Melibiase_C	2.36e-08	606	666	16	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
COG3345	GalA	7.18e-05	272	440	284	462	Alpha-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJR78498.1	6.66e-180	30	668	40	675
AII66839.1	1.88e-179	30	668	40	675
ALA72670.1	1.88e-179	30	668	40	675
QJR53686.1	1.88e-179	30	668	40	675
QJR61515.1	1.88e-179	30	668	40	675

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000316	0.998928	0.000249	0.000168	0.000167	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003835_02504.