CAZyme Information: MGYG000003831_02744

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000003831_02744
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
163		18900.35	10.5112

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003831	3246644	MAG	United States	North America

• Gene Location: Start: 931; End: 1422 Strand: -

Full Sequence      

MKKLLFFFVALLTLAAATPVHATKRSIMELPLFERAVLIIKKFETMHHPKHWPYIGYGHC
VQPGEPYRRGCQLTEAQADALLRKDLRKFCALYSQYGKDSVLLGALAYNCGPGIVNKSSI
LKKLRRGDRNIFKEYTAHCRYKGKFHKQLHQRRMTEFAALYVR

Enzyme Prediction     

No EC number prediction in MGYG000003831_02744.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	48	156	1.7e-16	0.8394160583941606

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	9.16e-16	36	130	1	104	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	4.42e-09	32	161	7	147	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16900	endolysin_R21-like	1.38e-07	36	129	8	109	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
pfam00959	Phage_lysozyme	4.14e-04	55	153	4	106	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.
pfam01464	SLT	0.007	92	133	77	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36945.1	3.55e-92	1	161	1	161
QCP71761.1	8.08e-77	1	161	1	160
QCD40659.1	8.08e-77	1	161	1	160
QCD38079.1	8.08e-77	1	161	1	160
QCP71601.1	3.40e-76	1	162	1	161

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000231	0.999180	0.000146	0.000152	0.000135	0.000129

TMHMM  Annotations     

start	end
5	23