CAZyme Information: MGYG000003816_00486

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000003816_00486
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		43232.43	6.6402

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003816	2849186	MAG	United States	North America

• Gene Location: Start: 4682; End: 5827 Strand: -

Full Sequence      

MKRITTVAIVLLTAAIWLPVSAASIDKLPPRKEIMKTLVKVNDHYIKQHPDPLKPIPYPS
RKKEYEANIWTRGVYFEGLMALHSIFPANRYLDYATRWAEGFKWGMRRDDTTTRNADNYC
CAQTYIDLYRLTPEPRRLTKTRALANMLAGTPQVDDWTWIDAIQMGLPVLVKMTVETGDQ
RYAEKGWEMYEWSRDSLAGGLFNKKEGLWWRDKDFVPPYKSPGGSNCYWSRGNGWVVAAL
VKALDELPAGAPHRDIYEKDLVAMCEALANCQREDGFWNVDLLDPTNFGGKELTGTALFV
YGMAWGVRNGLLDREKYMPVITKAWNAMVGDAVHEDGRLGYVQGTGKEPKDGQPVTFDSV
PDFDDFGTGCFLLAGSEVYRL

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	63	380	3.9e-86	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	5.00e-95	39	381	3	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.31e-47	70	381	36	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
cd00688	ISOPREN_C2_like	0.006	219	324	64	165	This group contains class II terpene cyclases, protein prenyltransferases beta subunit, two broadly specific proteinase inhibitors alpha2-macroglobulin (alpha (2)-M) and pregnancy zone protein (PZP) and, the C3 C4 and C5 components of vertebrate complement. Class II terpene cyclases include squalene cyclase (SQCY) and 2,3-oxidosqualene cyclase (OSQCY), these integral membrane proteins catalyze a cationic cyclization cascade converting linear triterpenes to fused ring compounds. The protein prenyltransferases include protein farnesyltransferase (FTase) and geranylgeranyltransferase types I and II (GGTase-I and GGTase-II) which catalyze the carboxyl-terminal lipidation of Ras, Rab, and several other cellular signal transduction proteins, facilitating membrane associations and specific protein-protein interactions. Alpha (2)-M is a major carrier protein in serum and involved in the immobilization and entrapment of proteases. PZP is a pregnancy associated protein. Alpha (2)-M and PZP are known to bind to and, may modulate, the activity of placental protein-14 in T-cell growth and cytokine production thereby protecting the allogeneic fetus from attack by the maternal immune system.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD42095.1	3.98e-228	1	381	1	376
QCP72533.1	1.31e-224	10	381	5	376
ADY37535.1	2.55e-174	22	381	14	371
QDH54558.1	2.93e-170	29	381	25	375
QDM11747.1	5.90e-170	9	381	5	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	2.10e-65	27	380	26	373	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.67e-61	58	380	27	356	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	7.58e-49	70	381	53	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	2.69e-15	67	329	36	312	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.11e-14	67	329	26	302	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	8.05e-51	70	381	58	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	4.89e-48	70	381	60	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	1.23e-44	22	378	41	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	1.47e-14	67	329	36	312	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000292	0.998996	0.000176	0.000169	0.000158	0.000147

TMHMM  Annotations     

start	end
7	25