CAZyme Information: MGYG000003794_00226

Basic Information

• Species: Prevotella timonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella timonensis
• CAZyme ID: MGYG000003794_00226
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
515	MGYG000003794_4|CGC1	58142.89	8.0447

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003794	2491297	MAG	Canada	North America

• Gene Location: Start: 41836; End: 43383 Strand: +

Full Sequence      

MKKLKTLSMMLAVAALTLLPSKGMAQFNWKYKIEGGKIVTEVPQRAAGQQSALLLKTPKL
KTVRVAFVGLGMRGPGAVERWTHIPGIQVMALCDYEKERAEDCQKYLRKASMPAADIYSG
EKGYEEICKRKDIDLVYIATDWLHHFPVAKCAMENGKHVAIEVPSAMNMHEIWQLIDLSE
KTRLHCVMLENCCYDFFELNSLNMAQKGLFGEVIYAQGAYRHELSPFWDHYWKKDQNDKL
GWRLDYNQKYRGDVYATHGLGPVAQVMNIHRGDRMKTLVAMDTKSFNGKKHVEQMSGKPC
EKFANGDQTTTLIRTEQGKVIEIHHNVMTPQPYNRMYQLTGTEGFANKYPVEGYALSSKN
MKQGGVSPSNDDLSGHEYLSKQDMKALEKAYASPLVTKYGDEAKEVGGHGGMDFIMDCRL
VYCLQNGLPMDIDVYDLAEWCCLAELGAISMDNGCLPVEVPDFTRGGWNTIKGYSHAFAS
PEEEAANDAQAKAFTATLKEKGKRYWEKIDKKKKK

Enzyme Prediction     

No EC number prediction in MGYG000003794_00226.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	59	470	4.8e-156	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.88e-19	61	354	2	265	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.03e-12	63	182	1	112	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	5.73e-06	132	215	64	147	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO49967.1	1.14e-307	3	512	2	511
QUB39974.1	2.48e-307	13	511	12	510
EFC71061.2	1.01e-306	1	515	1	514
QYR11531.1	5.82e-306	1	512	1	512
QUI92926.1	7.88e-304	18	510	17	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	1.41e-82	56	470	36	440	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.00e-63	61	472	19	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3E9M_A	1.47e-08	99	219	39	154	CrystalStructure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_B Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_C Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis],3E9M_D Crystal Structure of an oxidoreductase from Enterococcus faecalis [Enterococcus faecalis]
3E82_A	1.26e-07	62	228	7	166	Crystalstructure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]
3F4L_A	1.52e-06	125	425	58	327	Crystalstructure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_B Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_C Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_D Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_E Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12],3F4L_F Crystal structure of a probable oxidoreductase yhhX in Triclinic form. Northeast Structural Genomics target ER647 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6L1Z2	1.72e-265	28	515	35	520	Glycosyl hydrolase family 109 protein 5 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_2041 PE=3 SV=1
A6KWM1	4.88e-257	26	506	34	510	Glycosyl hydrolase family 109 protein 4 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0105 PE=3 SV=1
A6KYY1	5.71e-228	2	500	5	499	Glycosyl hydrolase family 109 protein 3 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0950 PE=3 SV=1
Q89ZX8	2.33e-207	1	479	1	466	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
A6KX96	7.47e-195	42	479	40	470	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000327	0.998888	0.000194	0.000220	0.000192	0.000176

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003794_00226.