CAZyme Information: MGYG000003792_01411

Basic Information

• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Brevibacteriaceae; Brevibacterium
• CAZyme ID: MGYG000003792_01411
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
432		48375.46	6.6706

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003792	2144916	MAG	Canada	North America

• Gene Location: Start: 4337; End: 5635 Strand: -

Full Sequence      

MFAAQPSIHNPVRPAGERIADGVAFAGMYFAHKFPERRKQMEWLLPAAKRAAEKTRERFA
IFSRQLGKDPRYQFPAPLDSSVVGSLPYDEMLTAYKDFKVFLNVNSVVDSPSMCARRIFE
LTACGTSVVTAPSEATRQAFPPNEVFQPANEGEAFHTTRALLRSHELRDRSVHLAQRRVW
ESHTYTHRATEIVRAAGVSTSETAQNKVSVLASTNRPQQLAHLFSQVGKQTVNPELVLIT
HGFAPSNEALRHLADSNDITDLKHQVAESTLTLGECLNMAVELATGTVLAKMDDDDLYGE
HYLDDALHALTYSGADLVGKNAHYMHLEAENVTVLRFPEREHKFTSLVMGPTMVGPRETF
ETVQFATRSTGEDTDFQTRILDNGGKIYSMDRFNFVQMRKESHTHTWSVTSAELLGNGVI
HSYGLPSDHYFF

Enzyme Prediction     

No EC number prediction in MGYG000003792_01411.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13524	Glyco_trans_1_2	1.71e-14	100	194	1	93	Glycosyl transferases group 1.
COG4641	COG4641	1.38e-07	2	193	168	356	Spore maturation protein CgeB [Cell cycle control, cell division, chromosome partitioning].
cd04195	GT2_AmsE_like	0.002	209	297	1	92	GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ79975.1	1.92e-150	2	432	196	635
QXQ08990.1	2.57e-149	2	432	193	629
BCW49561.1	4.39e-148	2	429	200	628
BCW46626.1	5.67e-148	2	429	197	625
BCW37343.1	6.21e-148	2	429	200	628

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003792_01411.