CAZyme Information: MGYG000003788_00338

Basic Information

• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Dethiosulfovibrionaceae; Pyramidobacter
• CAZyme ID: MGYG000003788_00338
• CAZy Family: GH133
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
195	MGYG000003788_8|CGC1	22293.48	8.2567

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003788	1935074	MAG	Canada	North America

• Gene Location: Start: 59; End: 646 Strand: +

Full Sequence      

MKSEFISRFWWESRSFLADVWRPDGADRSFRPNQIFAASLPEPLLDRERSGAMVEQVRRR
LLTPFGLRTLAPSEAGYCSLYEGGPAQRDFAYHQGTVWPWLLGAYCDALIASTLEHQRVL
QDFLTEITPLFVRHLRRYGVGSIAEIFDAAPPYRPNGCIAQAWSVAEVYRALKTVERKVP
SVFAQWEARLAKEAI

Enzyme Prediction     

No EC number prediction in MGYG000003788_00338.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH133	2	170	2.5e-49	0.45698924731182794

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06202	GDE_C	1.04e-55	2	170	203	374	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3408	GDB1	9.13e-33	15	172	456	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
TIGR01531	glyc_debranch	4.66e-11	27	172	1307	1461	glycogen debranching enzymye. glycogen debranching enzyme possesses two different catalytic activities; oligo-1,4-->1,4-glucantransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33). Site directed mutagenesis studies in S. cerevisiae indicate that the transferase and glucosidase activities are independent and located in different regions of the polypeptide chain. Proteins in this model belong to the larger alpha-amylase family. The model covers eukaryotic proteins with a seed composed of human, nematode and yeast sequences. Yeast seed sequence is well characterized. The model is quite rigorous; either query sequence yields large bit score or it fails to hit the model altogether. There doesn't appear to be any middle ground. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTO39855.1	1.66e-64	1	191	501	692
AMD88862.1	1.83e-64	1	187	479	666
SFV72707.1	1.32e-63	1	190	486	677
VZH34337.1	2.11e-62	1	187	484	671
QCC84806.1	9.81e-61	1	191	502	693

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P35573	7.78e-13	27	172	1374	1529	Glycogen debranching enzyme OS=Homo sapiens OX=9606 GN=AGL PE=1 SV=3
P35574	6.57e-12	27	172	1397	1552	Glycogen debranching enzyme OS=Oryctolagus cuniculus OX=9986 GN=AGL PE=1 SV=1
Q2PQH8	8.90e-12	27	172	1375	1530	Glycogen debranching enzyme OS=Canis lupus familiaris OX=9615 GN=AGL PE=2 SV=1
A8BQB4	1.64e-11	27	172	1375	1530	Glycogen debranching enzyme OS=Equus caballus OX=9796 GN=AGL PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003788_00338.