CAZyme Information: MGYG000003772_00822

Basic Information

• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Negativicoccaceae
• CAZyme ID: MGYG000003772_00822
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
185		21569.26	5.5322

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003772	1021183	MAG	Canada	North America

• Gene Location: Start: 4181; End: 4738 Strand: -

Full Sequence      

MNRRRGHNAHIGWWLVIAWVLWFWCGGNDYLTHNWFYRIEYRPLITHYAQANDLPPELVA
AVIYTESRFAPDAESSRGAVGLMQLMPETAEWVAEQQGTTVHDLRDPEENIRLGTWYLRY
LRTRFASPEMALAAYNAGHGHVEDWLEAAEAARVPLSVEAIPFPETREFVKSVTERQAEY
QIHWQ

Enzyme Prediction     

No EC number prediction in MGYG000003772_00822.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	55	178	2e-32	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	8.14e-65	39	173	2	140	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.53e-55	41	181	6	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.01e-41	56	178	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	4.80e-37	45	150	1	107	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.59e-34	48	149	4	106	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNV63004.1	1.76e-40	28	181	23	177
BAE83135.1	3.85e-40	37	181	42	189
ACL20501.1	3.85e-40	37	181	42	189
CDX01354.1	3.85e-40	37	181	42	189
BBU34602.1	7.08e-40	28	181	23	177

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	5.84e-21	31	180	406	555	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	5.86e-21	31	180	410	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	5.89e-21	31	180	416	565	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	5.91e-21	31	180	420	569	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	5.93e-21	31	180	426	575	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	3.33e-20	4	181	448	626	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC4	1.55e-19	13	181	455	626	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	1.55e-19	13	181	455	626	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
A8ZWR8	3.46e-15	40	174	285	425	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
O31608	2.13e-14	57	174	76	176	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.980233	0.014864	0.003446	0.000037	0.000037	0.001413

TMHMM  Annotations     

start	end
10	32